Lus10029879 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05590 307 / 2e-108 RPL18 ribosomal protein L18 (.1)
AT5G27850 306 / 6e-108 Ribosomal protein L18e/L15 superfamily protein (.1)
AT2G47570 220 / 1e-74 Ribosomal protein L18e/L15 superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041264 345 / 5e-123 AT5G27850 330 / 4e-117 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10015198 338 / 2e-120 AT3G05590 333 / 2e-118 ribosomal protein L18 (.1)
Lus10031485 340 / 1e-118 AT3G05590 333 / 9e-116 ribosomal protein L18 (.1)
Lus10020659 342 / 3e-117 AT3G05580 562 / 0.0 type one protein phosphatase 9, Calcineurin-like metallo-phosphoesterase superfamily protein (.1)
Lus10021971 340 / 5e-115 AT5G42390 629 / 0.0 stromal processing peptidase, Insulinase (Peptidase family M16) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G202800 330 / 3e-117 AT3G05590 340 / 3e-121 ribosomal protein L18 (.1)
Potri.014G127300 330 / 5e-117 AT3G05590 334 / 8e-119 ribosomal protein L18 (.1)
Potri.013G013600 326 / 1e-115 AT3G05590 337 / 8e-120 ribosomal protein L18 (.1)
Potri.005G023500 323 / 2e-114 AT3G05590 320 / 2e-113 ribosomal protein L18 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10029879 pacid=23159858 polypeptide=Lus10029879 locus=Lus10029879.g ID=Lus10029879.BGIv1.0 annot-version=v1.0
ATGGGGATCGATTTGAAGGCAGGAGGTAAGAGAAAGAAGACCAAGCGCACGGCGCCAAAGTCGAATGATATCTACCTCAAGCTTCTCGTTAAGCTGTACC
GATTCCTGGTTAGGAGAACTGGTAGTAGCTTCAATGCTGTGATATTGAAAAGGCTGTTTATGAGCAAGGTTAACAAGCCTCCGCTTTCCCTCTCCAGACT
CATTCGATTCACTAAAGGAAAGGAGGGAAAGATTGCTGTGGTTGTGGGAACAATCACTGATGACATTAGGGTTTATGACGTTCCAGCTATGAAGGTTACT
GCATTGAGGTTCACTGAAACTGCCAGGGCTAGAATTGAAAAGGCTGGTGGTGAATGCTTGACTTTTGATCAGCTTGCTCTGAGAGCTCCTCTTGGCCAGA
ACACGGTTCTACTCCGAGGTCCCAAGAATGCTCGTGAGGCAGTGAAGCACTTTGGCCCAGCTCCAGGTGTGCCACACAGCCACACCAAGCCTTACGTCAG
GTCGAAGGGAAGGAAGTTCGAAAAGGCTAGGGGGAGGAGGAACAGCAGAGGATTCAGGGTTTAA
AA sequence
>Lus10029879 pacid=23159858 polypeptide=Lus10029879 locus=Lus10029879.g ID=Lus10029879.BGIv1.0 annot-version=v1.0
MGIDLKAGGKRKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYDVPAMKVT
ALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10029879 0 1
AT5G02960 Ribosomal protein S12/S23 fami... Lus10026479 2.4 0.8898
AT2G27530 PGY1 PIGGYBACK1, Ribosomal protein ... Lus10004871 2.4 0.8858
AT2G42740 RPL16A ribosomal protein large subuni... Lus10029824 4.6 0.8925
AT5G48760 Ribosomal protein L13 family p... Lus10022793 6.7 0.8761
AT1G09970 RLK7, LRRXI-23 ... receptor-like kinase 7, Leucin... Lus10020500 7.7 0.8627
AT1G09640 Translation elongation factor ... Lus10007150 8.0 0.7686
AT5G48760 Ribosomal protein L13 family p... Lus10011857 9.4 0.8796
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10009578 9.5 0.8757
AT1G09690 Translation protein SH3-like f... Lus10030882 10.6 0.8711
AT3G25230 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rota... Lus10002338 11.2 0.8757

Lus10029879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.