Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27700 84 / 1e-22 Ribosomal protein S21e (.1) AT3G53890 78 / 4e-20 Ribosomal protein S21e (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031494 [exp] 98 / 4e-28 AT5G27700 89 / 2e-25 Ribosomal protein S21e (.1) Lus10015173 [exp] 92 / 2e-25 AT5G27700 151 / 1e-49 Ribosomal protein S21e (.1) Lus10010971 [exp] 86 / 5e-22 AT5G27700 128 / 7e-39 Ribosomal protein S21e (.1) Lus10020645 [exp] 0 / 1 AT5G27700 151 / 7e-50 Ribosomal protein S21e (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G017600 [exp] 88 / 3e-24 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1) Potri.005G026000 [exp] 88 / 3e-24 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01249 [flax] [poplar] Ribosomal_S21e Ribosomal protein S21e
Representative CDS sequence Show only first row Show all	>Lus10029895 pacid=23159731 polypeptide=Lus10029895 locus=Lus10029895.g ID=Lus10029895.BGIv1.0 annot-version=v1.0 ATGCAGAACGAAGAGGGTAACAACGTGGATCTCTACATCCCGAGGAAATGCTCCGCCACTAACAGGCTGATTACCTCGAAGGACCACGCCTCCGTCCAGA TCAATGTTGGACATTTGGACGCTAACGGCCGGGGGGACCGCGCGTGCACACCGGCCAGTTCACCACCTTTGCCCTCTGCGGATTCGTCCGTGCTCAGGGT GATGGAGACAGCGGCCTTGACAGGCTGTGGCAGAAGAAGAAAGCCGAACTCAGGCAATGATAGGATCACAGCCGCTGTGTTTGCAACGTTGTTACGAGCG AGGTGGAGAGAAGTGGGTTTGAGAGTGTTTCGCTAG
AA sequence Show only first row Show all	>Lus10029895 pacid=23159731 polypeptide=Lus10029895 locus=Lus10029895.g ID=Lus10029895.BGIv1.0 annot-version=v1.0 MQNEEGNNVDLYIPRKCSATNRLITSKDHASVQINVGHLDANGRGDRACTPASSPPLPSADSSVLRVMETAALTGCGRRRKPNSGNDRITAAVFATLLRA RWREVGLRVFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27700			Ribosomal protein S21e (.1)		Lus10029895 [exp]	0	1
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10000165 [exp]	2.2	0.9507
AT4G15770			RNA binding (.1)		Lus10037509 [exp]	2.4	0.9541
AT3G09630			Ribosomal protein L4/L1 family...		Lus10014431 [exp]	2.8	0.9580
AT2G27710			60S acidic ribosomal protein f...		Lus10006270 [exp]	3.6	0.9376
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10012057 [exp]	3.7	0.9436
AT2G42740		RPL16A	ribosomal protein large subuni...		Lus10020715 [exp]	4.6	0.9582
AT5G24510			60S acidic ribosomal protein f...		Lus10008943 [exp]	7.1	0.9292
AT2G04390			Ribosomal S17 family protein (...		Lus10004208 [exp]	8.0	0.9528
AT3G02080			Ribosomal protein S19e family ...		Lus10021865 [exp]	11.2	0.9182
AT1G48830			Ribosomal protein S7e family p...		Lus10028789 [exp]	12.0	0.9457

Compare expression of checked genes

Lus10029895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.