Lus10029919 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41750 92 / 1e-21 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT5G38850 92 / 2e-21 Disease resistance protein (TIR-NBS-LRR class) (.1)
AT5G17680 91 / 8e-21 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT1G63880 89 / 2e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G40910 89 / 3e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G56540 88 / 6e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G36930 87 / 9e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT1G65850 87 / 9e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT4G16990 87 / 1e-19 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
AT1G72930 82 / 2e-19 TIR toll/interleukin-1 receptor-like (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004482 288 / 1e-98 AT1G56540 111 / 2e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10029921 138 / 6e-39 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10041606 130 / 1e-36 AT5G36930 140 / 5e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10026845 129 / 3e-36 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10006929 121 / 1e-33 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Lus10014671 121 / 2e-33 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10027920 118 / 1e-31 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10006928 115 / 2e-29 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10030498 103 / 3e-27 AT5G36930 115 / 2e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G096849 97 / 5e-25 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G070436 96 / 9e-25 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Potri.019G017082 101 / 1e-24 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G019053 100 / 4e-24 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T002200 99 / 6e-24 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.005G004500 96 / 6e-24 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.005G032000 93 / 7e-24 AT2G20142 127 / 9e-37 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Potri.013G098100 93 / 9e-24 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G016425 98 / 2e-23 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G069866 93 / 2e-23 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10029919 pacid=23159832 polypeptide=Lus10029919 locus=Lus10029919.g ID=Lus10029919.BGIv1.0 annot-version=v1.0
ATGATAGTATCTATTTTACTTGTTGCATTCTTCCACCTTCTCTTTCTATCATGTCTCCCTTCCTCCTCTTACTTAACCACCGTCACCTCCCCATTCTCTT
TTTTCCTTCGGTTAATCAGAATTATAACAGATCGATCACATCTGCCACCATCCTACGACGTGTTCATTTCCTTCAGAGGTCCCGATGTGCGGTACACGTT
CAAGGAGCACCTTCGCGCTGCCATCGAGCGAAAGGGGCTGACAGTGTTCTGCGACGACGGCGAGGAGCTGCGCGGCCAAATAGTACAGGAGTCCATCCTC
AGCGGGATAGAGAGATCCACCTGCCACGTTGTAGTGCTCTCAGAGAAGTTTGCTTCCTCCACATACTGCCTGGATGAGCTGGTCAAGATCATGGAATGCT
CTACTGCCGCCGCCGGTAGGGGAAGCTACTGTCTGCCGGTTTTCTACAGAATTCCGGCGGCTGATCCGTCCGGAGGTTGCTTCAAGAAAGACTTGGAGCT
CCACATGAAGAGCTGCAGTTATGAAAGAGTGCAAGGCTGGATCCGGGCACTTGGTTGGCTTCGTGGCTTAGGCGGCTGGGTTTGCACCGGCAAAGAGTCT
GAAGCGAAGTTGGTGGAGACCATTGCCACAACAATCCAGGAGAAGGTAATGGAACTAGCTTAA
AA sequence
>Lus10029919 pacid=23159832 polypeptide=Lus10029919 locus=Lus10029919.g ID=Lus10029919.BGIv1.0 annot-version=v1.0
MIVSILLVAFFHLLFLSCLPSSSYLTTVTSPFSFFLRLIRIITDRSHLPPSYDVFISFRGPDVRYTFKEHLRAAIERKGLTVFCDDGEELRGQIVQESIL
SGIERSTCHVVVLSEKFASSTYCLDELVKIMECSTAAAGRGSYCLPVFYRIPAADPSGGCFKKDLELHMKSCSYERVQGWIRALGWLRGLGGWVCTGKES
EAKLVETIATTIQEKVMELA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G36930 Disease resistance protein (TI... Lus10029919 0 1

Lus10029919 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.