Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 66 / 5e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G40100 66 / 7e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72840 63 / 5e-13 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT5G17680 62 / 9e-13 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G17600 61 / 3e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G48770 61 / 3e-12 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G18370 59 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G49140 59 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72860 59 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72940 59 / 1e-11 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030498 [exp] 85 / 9e-22 AT5G36930 115 / 2e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10012852 [exp] 81 / 6e-20 AT5G17680 100 / 1e-23 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10009500 [exp] 79 / 1e-19 AT1G72940 115 / 4e-30 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) Lus10014829 [exp] 74 / 1e-16 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10004482 [exp] 70 / 1e-15 AT1G56540 111 / 2e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10029919 [exp] 68 / 2e-15 AT5G36930 105 / 5e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10013729 [exp] 69 / 6e-15 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005588 [exp] 69 / 8e-15 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10027920 [exp] 67 / 1e-14 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G001602 [exp] 67 / 1e-14 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002300 [exp] 66 / 8e-14 AT5G36930 635 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019053 [exp] 64 / 2e-13 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 64 / 2e-13 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 64 / 2e-13 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G016425 [exp] 64 / 2e-13 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G032000 [exp] 62 / 2e-13 AT2G20142 127 / 9e-37 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.T126506 [exp] 63 / 4e-13 AT3G14470 575 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.005G004233 [exp] 62 / 6e-13 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.019G001971 [exp] 62 / 9e-13 AT5G36930 427 / 3e-130 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10029927 pacid=23159645 polypeptide=Lus10029927 locus=Lus10029927.g ID=Lus10029927.BGIv1.0 annot-version=v1.0 ATGCCACGCGTCCATAGCTCACGAAGCAAGCGCTCATCGCGAAGGCCGTCGCACTACGACGTATTCGTGAGCTTTCGAGGACCCCACGTCCGCTACAGAT TCCTAGGCCATCTGTTCTCTGCGTTCAAGACAAAGAAGGTGAGACCGTTCAAGGACGACGTGGACCTGACCAGGGGCGAGAACAGGAAAGAAGGGATACA GAGGGGGATCGAGAAGTCGAGCATTTATGTCGTCGTTTTGACCGAGAACTATGCCTACGTCTACGTGGTGCTTGGATGA
AA sequence Show only first row Show all	>Lus10029927 pacid=23159645 polypeptide=Lus10029927 locus=Lus10029927.g ID=Lus10029927.BGIv1.0 annot-version=v1.0 MPRVHSSRSKRSSRRPSHYDVFVSFRGPHVRYRFLGHLFSAFKTKKVRPFKDDVDLTRGENRKEGIQRGIEKSSIYVVVLTENYAYVYVVLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10029927 [exp]	0	1

Compare expression of checked genes

Lus10029927 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.