Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08990 53 / 3e-10 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1) AT1G54940 51 / 2e-09 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1) AT3G18660 40 / 9e-06 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) AT1G77130 36 / 0.0004 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029932 [exp] 76 / 5e-18 AT1G54940 527 / 0.0 plant glycogenin-like starch initiation protein 4 (.1) Lus10031507 [exp] 50 / 5e-09 AT1G54940 542 / 0.0 plant glycogenin-like starch initiation protein 4 (.1) Lus10020890 [exp] 39 / 4e-05 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Lus10018922 [exp] 39 / 4e-05 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Lus10028623 [exp] 36 / 0.0003 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Lus10021731 [exp] 36 / 0.0004 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) Lus10042658 [exp] 35 / 0.0006 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G033500 [exp] 61 / 4e-13 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1) Potri.013G022900 [exp] 58 / 5e-12 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1) Potri.014G029900 [exp] 42 / 3e-06 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) Potri.005G061600 [exp] 36 / 0.0002 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Potri.007G107200 [exp] 36 / 0.0003 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Potri.005G187900 [exp] 36 / 0.0004 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029931 pacid=23159865 polypeptide=Lus10029931 locus=Lus10029931.g ID=Lus10029931.BGIv1.0 annot-version=v1.0 ATGCCCGAAGGGTTGCAAGAGTATTGTGGGTTGACTAGGAAGATGGATGATAAGATTAAGAAGTGGAGGATGAGTGCTGAGAGTAACAAGTTCAAGAATG GACGGTGGAGGATTCGAGTGACTGATCCCAGAAAAGATAACTTGGTTGAATGA
AA sequence Show only first row Show all	>Lus10029931 pacid=23159865 polypeptide=Lus10029931 locus=Lus10029931.g ID=Lus10029931.BGIv1.0 annot-version=v1.0 MPEGLQEYCGLTRKMDDKIKKWRMSAESNKFKNGRWRIRVTDPRKDNLVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08990		PGSIP5	plant glycogenin-like starch i...		Lus10029931 [exp]	0	1

Compare expression of checked genes

Lus10029931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.