Lus10029931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08990 53 / 3e-10 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1)
AT1G54940 51 / 2e-09 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1)
AT3G18660 40 / 9e-06 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
AT1G77130 36 / 0.0004 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029932 76 / 5e-18 AT1G54940 527 / 0.0 plant glycogenin-like starch initiation protein 4 (.1)
Lus10031507 50 / 5e-09 AT1G54940 542 / 0.0 plant glycogenin-like starch initiation protein 4 (.1)
Lus10020890 39 / 4e-05 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10018922 39 / 4e-05 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10028623 36 / 0.0003 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10021731 36 / 0.0004 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10042658 35 / 0.0006 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G033500 61 / 4e-13 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.013G022900 58 / 5e-12 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.014G029900 42 / 3e-06 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Potri.005G061600 36 / 0.0002 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.007G107200 36 / 0.0003 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.005G187900 36 / 0.0004 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
PFAM info
Representative CDS sequence
>Lus10029931 pacid=23159865 polypeptide=Lus10029931 locus=Lus10029931.g ID=Lus10029931.BGIv1.0 annot-version=v1.0
ATGCCCGAAGGGTTGCAAGAGTATTGTGGGTTGACTAGGAAGATGGATGATAAGATTAAGAAGTGGAGGATGAGTGCTGAGAGTAACAAGTTCAAGAATG
GACGGTGGAGGATTCGAGTGACTGATCCCAGAAAAGATAACTTGGTTGAATGA
AA sequence
>Lus10029931 pacid=23159865 polypeptide=Lus10029931 locus=Lus10029931.g ID=Lus10029931.BGIv1.0 annot-version=v1.0
MPEGLQEYCGLTRKMDDKIKKWRMSAESNKFKNGRWRIRVTDPRKDNLVE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08990 PGSIP5 plant glycogenin-like starch i... Lus10029931 0 1

Lus10029931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.