Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51550 63 / 8e-13 FER FERONIA, Malectin/receptor-like protein kinase family protein (.1) AT5G28680 61 / 4e-12 ANX2 ANXUR2, Malectin/receptor-like protein kinase family protein (.1) AT4G39110 59 / 1e-11 Malectin/receptor-like protein kinase family protein (.1) AT3G04690 58 / 3e-11 ANX1 ANXUR1, Malectin/receptor-like protein kinase family protein (.1) AT2G21480 57 / 6e-11 Malectin/receptor-like protein kinase family protein (.1) AT5G59700 52 / 4e-09 Protein kinase superfamily protein (.1) AT5G39000 51 / 8e-09 Malectin/receptor-like protein kinase family protein (.1) AT5G61350 51 / 1e-08 Protein kinase superfamily protein (.1) AT3G46290 50 / 2e-08 HERK1 hercules receptor kinase 1 (.1) AT5G38990 49 / 3e-08 Malectin/receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003942 [exp] 124 / 3e-34 AT3G51550 656 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10032971 [exp] 105 / 7e-28 AT3G51550 706 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10032976 [exp] 103 / 5e-27 AT3G51550 682 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10042537 [exp] 60 / 9e-12 AT3G04690 942 / 0.0 ANXUR1, Malectin/receptor-like protein kinase family protein (.1) Lus10037767 [exp] 59 / 1e-11 AT3G04690 405 / 2e-136 ANXUR1, Malectin/receptor-like protein kinase family protein (.1) Lus10016907 [exp] 59 / 2e-11 AT3G04690 967 / 0.0 ANXUR1, Malectin/receptor-like protein kinase family protein (.1) Lus10021998 [exp] 59 / 2e-11 AT3G04690 929 / 0.0 ANXUR1, Malectin/receptor-like protein kinase family protein (.1) Lus10014185 [exp] 59 / 3e-11 AT3G51550 1254 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10039274 [exp] 58 / 3e-11 AT5G24010 997 / 0.0 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G095632 [exp] 70 / 1e-15 AT3G51550 403 / 2e-134 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096400 [exp] 69 / 3e-15 AT3G51550 451 / 6e-151 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096600 [exp] 69 / 5e-15 AT3G51550 829 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096000 [exp] 69 / 7e-15 AT3G51550 832 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G095900 [exp] 68 / 8e-15 AT3G51550 845 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096800 [exp] 66 / 5e-14 AT3G51550 823 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.006G110000 [exp] 65 / 1e-13 AT3G51550 1256 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.016G138700 [exp] 62 / 8e-13 AT3G51550 1252 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G143049 [exp] 60 / 6e-12 AT5G24010 1071 / 0.0 Protein kinase superfamily protein (.1) Potri.010G140000 [exp] 60 / 7e-12 AT3G51550 696 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029946 pacid=23159725 polypeptide=Lus10029946 locus=Lus10029946.g ID=Lus10029946.BGIv1.0 annot-version=v1.0 ATGGTTGACCCTCATTTGGATGGGGAGATTGCAGAGGAGTGTCTACACATGTTTGCGGAGGTTGCCGTGAGTTGCTTGAAGAAGAAGGGAGTTGATAGGC CATCGATGGAGGATGTGGTACGGGGGCTTGCATTCGCCATGGAGTTACAGGAGAAAGAAGGTAGGGGCGTGAAGGTACTAGAGAAGAAGCGTGTCGAGGA CGGATTGGCGATGATGAATAATGGTCCTTCAAGCAGCAGTAGTAGCAGCCCCAGTTTTGAAAACTTTGTTAATAATTGTTCAGCATAA
AA sequence Show only first row Show all	>Lus10029946 pacid=23159725 polypeptide=Lus10029946 locus=Lus10029946.g ID=Lus10029946.BGIv1.0 annot-version=v1.0 MVDPHLDGEIAEECLHMFAEVAVSCLKKKGVDRPSMEDVVRGLAFAMELQEKEGRGVKVLEKKRVEDGLAMMNNGPSSSSSSSPSFENFVNNCSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Lus10029946 [exp]	0	1
AT1G10340			Ankyrin repeat family protein ...		Lus10038608 [exp]	2.4	0.9182
AT5G47230	AP2_ERF	ATERF5, ATERF-5...	ETHYLENE RESPONSIVE ELEMENT BI...		Lus10004369 [exp]	5.3	0.9060
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10037226 [exp]	5.7	0.8679
AT1G10340			Ankyrin repeat family protein ...		Lus10038609 [exp]	6.0	0.8684
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10010864 [exp]	7.3	0.8856
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020491 [exp]	8.9	0.8628
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020492 [exp]	9.5	0.8502
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10015286 [exp]	10.0	0.8794
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10036697 [exp]	10.0	0.8830
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Lus10039771 [exp]	10.4	0.8535

Compare expression of checked genes

Lus10029946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.