Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05210 136 / 1e-39 UVR7, ERCC1 UV REPAIR DEFICIENT 7, nucleotide repair protein, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004462 [exp] 199 / 6e-64 AT3G05210 465 / 2e-163 UV REPAIR DEFICIENT 7, nucleotide repair protein, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G036700 [exp] 150 / 6e-45 AT3G05210 423 / 5e-147 UV REPAIR DEFICIENT 7, nucleotide repair protein, putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029947 pacid=23159647 polypeptide=Lus10029947 locus=Lus10029947.g ID=Lus10029947.BGIv1.0 annot-version=v1.0 ATGATTCAGTTGCAGCATGCTCTCACAAGTGTTAGACATGTTAACAAGACGGATGTAGTCACACTTGGATCGACATTTGGGTCTCTATCAAGTATAATGG ATGCATCAATGGAGGATCTAGCCCGTTGTCCCGGTATAGGAGAACGCAAGGTGAAATGGTTACAGGATACTTTTCATGAGCCGTTCAAGCGGATAGTTTT CAGTCAACCTGTAGTTCCTGAAACTACGACTCGAGGACTTCCCAATGAAGAACAAGCTAGCAAAGCAGGAGTAGAGACGGAAGAAGAAGGAGAATCAAAT AGGCGCAGGAAGAAAGAACCTGAGAAGACAGTCAAATCCGCCTTTGGCTGCTGCATTTGCTAA
AA sequence Show only first row Show all	>Lus10029947 pacid=23159647 polypeptide=Lus10029947 locus=Lus10029947.g ID=Lus10029947.BGIv1.0 annot-version=v1.0 MIQLQHALTSVRHVNKTDVVTLGSTFGSLSSIMDASMEDLARCPGIGERKVKWLQDTFHEPFKRIVFSQPVVPETTTRGLPNEEQASKAGVETEEEGESN RRRKKEPEKTVKSAFGCCIC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05210		UVR7, ERCC1	UV REPAIR DEFICIENT 7, nucleot...		Lus10029947 [exp]	0	1
AT3G07960		PIP5K6	phosphatidylinositol-4-phospha...		Lus10024151 [exp]	3.5	0.8898
AT2G20840			Secretory carrier membrane pro...		Lus10031627 [exp]	4.7	0.8663
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10014406 [exp]	5.5	0.9145
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Lus10026188 [exp]	8.5	0.9119
					Lus10019824 [exp]	8.6	0.7933
AT2G47880			Glutaredoxin family protein (....		Lus10005937 [exp]	10.3	0.8135
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10028306 [exp]	11.1	0.9039
AT4G39480		CYP96A9	"cytochrome P450, family 96, s...		Lus10018157 [exp]	11.2	0.8012
AT5G63080			2-oxoglutarate (2OG) and Fe(II...		Lus10042091 [exp]	12.0	0.7319
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	12.3	0.9023

Compare expression of checked genes

Lus10029947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.