Plant FIBer expression Database

Lus10029969 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54740 58 / 2e-10 Protein of unknown function (DUF3049) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035353
[exp]
189 / 3e-60 AT1G54740 93 / 1e-21 Protein of unknown function (DUF3049) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G037600
[exp]
72 / 3e-15 AT1G54740 104 / 7e-26 Protein of unknown function (DUF3049) (.1)
Potri.013G027100
[exp]
71 / 7e-15 AT1G54740 103 / 1e-25 Protein of unknown function (DUF3049) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11250 FAF Fantastic Four meristem regulator
Representative CDS sequence
>Lus10029969 pacid=23159681 polypeptide=Lus10029969 locus=Lus10029969.g ID=Lus10029969.BGIv1.0 annot-version=v1.0
ATGGCAGACAAATTGATCGAGCCGATATCGTCGCTGAACAAGAACGGCCAGCCGAATTTCTTTCTCCGTCCGGTGAGGAGGAACGGCCGGCTGGAGCTGA
CGGAGGTGAGGATCGACCGGCCAGAGGTTCTCAGGGCGACGAGGGAAGATGGACGGCTGCGATTGCTTCTCGTCCGGGATGAACTCGAGGTCGATGATGA
GGTGGAAGAGGAGGACCAACAGAATCCGGAAAATACGGAGTTGGATTCGATCGAGGAAGATGATCGGGTGGAAGAAACGGCGTCGTTTTGCATGGAGTCG
GAAGAAAGAGAAGAGGAAGAAGAAGAAGAAGAGAAGGGAACTTCGTGGTCTTCGTCGGAGGAAGAGGGGGATATTAGGAGAGAGGAGTGGAATTTTCCGG
TGAACGGAGAAGGATTCAGGCGGTGTTACGATCTAGTGAACCACCGCCACGTAGGCGGCGGCGGCGAAATGCACATGTGGAGGCAACATTGCGTGACAAC
CAGGTGA
AA sequence
>Lus10029969 pacid=23159681 polypeptide=Lus10029969 locus=Lus10029969.g ID=Lus10029969.BGIv1.0 annot-version=v1.0
MADKLIEPISSLNKNGQPNFFLRPVRRNGRLELTEVRIDRPEVLRATREDGRLRLLLVRDELEVDDEVEEEDQQNPENTELDSIEEDDRVEETASFCMES
EEREEEEEEEEKGTSWSSSEEEGDIRREEWNFPVNGEGFRRCYDLVNHRHVGGGGEMHMWRQHCVTTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G54740 Protein of unknown function (D... Lus10029969
[exp]
0 1
AT1G77660 Histone H3 K4-specific methylt... Lus10028062
[exp]
4.9 0.8201
AT2G46860 ATPPA3 pyrophosphorylase 3 (.1) Lus10041767
[exp]
14.0 0.8088
AT1G54740 Protein of unknown function (D... Lus10035353
[exp]
18.3 0.8047
AT1G59960 NAD(P)-linked oxidoreductase s... Lus10029208
[exp]
20.5 0.7351
AT5G58110 chaperone binding;ATPase activ... Lus10028103
[exp]
23.1 0.7872
AT3G25120 Mitochondrial import inner mem... Lus10013127
[exp]
26.8 0.8029
AT1G24050 RNA-processing, Lsm domain (.1... Lus10010705
[exp]
28.9 0.8071
AT5G27660 Trypsin family protein with PD... Lus10017093
[exp]
32.9 0.7788
AT1G22900 Disease resistance-responsive ... Lus10025804
[exp]
37.3 0.7903
AT1G20575 DPMS1 dolichol phosphate mannose syn... Lus10013228
[exp]
38.4 0.7917

Lus10029969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.