Lus10029970 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54730 115 / 4e-31 Major facilitator superfamily protein (.1.2.3)
AT3G05400 106 / 6e-27 Major facilitator superfamily protein (.1.2)
AT2G48020 106 / 6e-27 Major facilitator superfamily protein (.1.2)
AT1G08930 103 / 7e-26 ERD6 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
AT3G05155 99 / 1e-24 Major facilitator superfamily protein (.1)
AT3G05165 97 / 1e-23 Major facilitator superfamily protein (.1.2.3.4.5)
AT5G27350 94 / 2e-22 SFP1 Major facilitator superfamily protein (.1)
AT3G05160 93 / 2e-22 Major facilitator superfamily protein (.1.2)
AT5G27360 93 / 5e-22 SFP2 Major facilitator superfamily protein (.1)
AT4G04760 92 / 8e-22 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029966 211 / 5e-66 AT1G54730 525 / 0.0 Major facilitator superfamily protein (.1.2.3)
Lus10035354 194 / 7e-60 AT1G54730 615 / 0.0 Major facilitator superfamily protein (.1.2.3)
Lus10033812 106 / 8e-27 AT1G08930 499 / 1e-174 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Lus10029965 100 / 4e-25 AT4G04750 283 / 2e-92 Major facilitator superfamily protein (.1)
Lus10029964 100 / 1e-24 AT1G54730 419 / 2e-142 Major facilitator superfamily protein (.1.2.3)
Lus10008183 99 / 4e-24 AT2G48020 657 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10027976 96 / 4e-23 AT2G48020 598 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10012780 96 / 6e-23 AT5G18840 685 / 0.0 Major facilitator superfamily protein (.1)
Lus10027975 96 / 8e-23 AT2G48020 626 / 0.0 Major facilitator superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G027500 159 / 1e-46 AT1G54730 606 / 0.0 Major facilitator superfamily protein (.1.2.3)
Potri.005G037000 117 / 9e-31 AT1G08920 483 / 3e-168 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Potri.013G027700 112 / 3e-29 AT1G08930 483 / 6e-168 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Potri.005G039900 108 / 9e-28 AT1G08920 461 / 1e-159 ERD (early response to dehydration) six-like 1 (.1), ERD (early response to dehydration) six-like 1 (.2), ERD (early response to dehydration) six-like 1 (.3)
Potri.014G136600 101 / 3e-25 AT2G48020 665 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.005G040000 101 / 5e-25 AT1G54730 429 / 2e-147 Major facilitator superfamily protein (.1.2.3)
Potri.010G026500 99 / 3e-24 AT5G18840 686 / 0.0 Major facilitator superfamily protein (.1)
Potri.002G212900 99 / 4e-24 AT2G48020 723 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.013G027800 94 / 3e-22 AT5G27360 405 / 6e-138 Major facilitator superfamily protein (.1)
Potri.002G259900 79 / 5e-17 AT1G75220 744 / 0.0 ERD6-like 6, Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Lus10029970 pacid=23159800 polypeptide=Lus10029970 locus=Lus10029970.g ID=Lus10029970.BGIv1.0 annot-version=v1.0
ATGGAAGAAGCAGAGATCTCAACCTCTTTGATTGAGAAACAAAGGCCTCAGCTCCAATCCAGGGGTGGAGAAGAAGACCAGAATGGTTCTTCTTCTTCTT
CTTCAGCTGCTTCAAGCATACTTATTTTGAGCACCATGGTAGCTGTCTCAGGTTGGCTAGCAATAGCATTTGCAAAGGTTACGTGGTGGCTTCATGCTGG
AAGGCTGCTTGTAGGATACGGGATGGGACTGCTTTCATATGTGGTTCCTGTGTTCATTGCCGAGATCACTCCGAAGAATCTTCGAGGAGGGTTCACCACA
GTTCACCAGGCAAAAGTTGGCAGAGGGAAAGAATGTGAATCTGTTCTACAGAAGCTGAGAGGGAAGGAATCTTATATTTCAGATGAAGCAGCTGAAATAA
GAGATTGTACTGAGACAGTTCAGAAGCATACTGAAGGCACCAACATGTTTGAGTTGTTCCAATGGAAATATGCTCATTCTCTCCTTGTTACTGCAGCAGG
AACTTGCTTGGGTTGCTTCCTTGTAGCACTCTCATTTCTGCTTCAGGTTTTCCCAATAAACATGAAGGGAACAGCAGGGAGCCTAGTGACATTGGTCAGC
TAG
AA sequence
>Lus10029970 pacid=23159800 polypeptide=Lus10029970 locus=Lus10029970.g ID=Lus10029970.BGIv1.0 annot-version=v1.0
MEEAEISTSLIEKQRPQLQSRGGEEDQNGSSSSSSAASSILILSTMVAVSGWLAIAFAKVTWWLHAGRLLVGYGMGLLSYVVPVFIAEITPKNLRGGFTT
VHQAKVGRGKECESVLQKLRGKESYISDEAAEIRDCTETVQKHTEGTNMFELFQWKYAHSLLVTAAGTCLGCFLVALSFLLQVFPINMKGTAGSLVTLVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05400 Major facilitator superfamily ... Lus10029970 0 1
AT4G37020 unknown protein Lus10000435 2.8 0.8640
AT5G13700 ATPAO1, APAO polyamine oxidase 1 (.1) Lus10041898 2.8 0.8500
AT5G57910 unknown protein Lus10036255 8.8 0.8338
AT3G25060 Tetratricopeptide repeat (TPR)... Lus10038187 9.2 0.8249
AT1G63460 ATGPX8 glutathione peroxidase 8 (.1) Lus10000601 13.0 0.8327
AT2G27790 RNA-binding (RRM/RBD/RNP motif... Lus10030600 15.5 0.8493
AT1G76200 unknown protein Lus10012279 15.9 0.8293
Lus10043057 16.1 0.8215
AT1G07745 SSN1, ATRAD51D,... SUPPRESOR OF SNI1, homolog of ... Lus10005437 19.6 0.8425
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10000920 20.6 0.8355

Lus10029970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.