Lus10029977 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G038200 60 / 1e-11 ND /
PFAM info
Representative CDS sequence
>Lus10029977 pacid=23159864 polypeptide=Lus10029977 locus=Lus10029977.g ID=Lus10029977.BGIv1.0 annot-version=v1.0
ATGGATCAAAGAGGCCAACAACACCTCCAACCTCTCACCATCTGCAACAGACTATACAACTTCATCATGAAATCATTAGCCACACAGGCCTTCAAGACTG
TCACCTTAGGCTGCTCAACAACTCCGCCACCGCACCATTTCATCAATGATGGGACTCGAGCCGATCTCGATGAAGGGAAGAGTGATGCTTTGGACGTGAA
GCCAGAGGAAGAGAAGGGGGCAAAGAAGACAACTTCCTCTTCATTGGCTAGCTTGCTTGCTAGTGAAGGAAGGGGGCCTCCAAAGAAAGTTGTTAGCATA
AATGAGAGGGCTGAGGAGATTGATGCTGGTAAGAGTAAGAAGATGGTGATGATTAGGAGGAAAGGTTCCAGTGAAAAGCTGGATCCTTTTGAAGGGCAAG
CTGGAGATTATGATAAGCCTTTGAGATCAATTCTTAAAGTGGGTTCAATGAGTTTAGGTGGGGAGTGA
AA sequence
>Lus10029977 pacid=23159864 polypeptide=Lus10029977 locus=Lus10029977.g ID=Lus10029977.BGIv1.0 annot-version=v1.0
MDQRGQQHLQPLTICNRLYNFIMKSLATQAFKTVTLGCSTTPPPHHFINDGTRADLDEGKSDALDVKPEEEKGAKKTTSSSLASLLASEGRGPPKKVVSI
NERAEEIDAGKSKKMVMIRRKGSSEKLDPFEGQAGDYDKPLRSILKVGSMSLGGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029977 0 1
AT1G66240 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.... Lus10034138 3.5 0.9286
AT4G22758 unknown protein Lus10006995 5.5 0.9312
AT1G21240 WAK3 wall associated kinase 3 (.1) Lus10013387 5.5 0.9273
AT1G70670 AtCLO4 Arabidopsis thaliana caleosin ... Lus10034325 6.2 0.9395
AT5G48920 TED7 tracheary element differentiat... Lus10028626 7.1 0.9469
AT3G27210 unknown protein Lus10011366 9.6 0.9430
AT4G22758 unknown protein Lus10000386 10.1 0.9090
Lus10003616 11.0 0.8704
Lus10000510 15.4 0.8926
AT4G35350 XCP1 xylem cysteine peptidase 1 (.1... Lus10030722 17.0 0.9391

Lus10029977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.