Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54790 92 / 3e-23 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) AT3G26430 75 / 3e-17 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G09390 74 / 9e-17 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G56670 70 / 3e-15 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G67830 68 / 1e-14 ATFXG1 Arabidopsis thaliana alpha-fucosidase 1, alpha-fucosidase 1 (.1) AT3G62280 66 / 4e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT4G01130 65 / 2e-13 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G05180 64 / 3e-13 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G27950 62 / 1e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G14450 58 / 3e-11 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029639 [exp] 80 / 6e-19 AT1G54790 421 / 4e-147 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029638 [exp] 80 / 1e-18 AT1G54790 443 / 2e-155 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029980 [exp] 79 / 1e-18 AT1G54790 578 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10006224 [exp] 68 / 1e-14 AT3G26430 342 / 5e-111 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10001522 [exp] 65 / 2e-13 AT1G09390 459 / 3e-162 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10012644 [exp] 62 / 2e-12 AT4G01130 494 / 1e-175 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10032094 [exp] 61 / 7e-12 AT5G14450 578 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10014592 [exp] 60 / 8e-12 AT5G14450 573 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10008784 [exp] 60 / 1e-11 AT3G27950 391 / 2e-135 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G038850 [exp] 88 / 7e-24 AT1G54790 66 / 1e-13 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.002G216000 [exp] 82 / 8e-20 AT1G54790 474 / 1e-167 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.005G038800 [exp] 73 / 3e-16 AT1G54790 595 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.005G006500 [exp] 72 / 4e-16 AT1G09390 506 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G177900 [exp] 70 / 4e-16 AT3G26430 154 / 2e-45 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.013G026300 [exp] 72 / 6e-16 AT1G54790 605 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.005G177700 [exp] 72 / 7e-16 AT3G26430 407 / 2e-141 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.008G185500 [exp] 71 / 9e-16 AT3G26430 534 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.002G083800 [exp] 69 / 5e-15 AT3G26430 405 / 8e-141 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.002G191100 [exp] 69 / 7e-15 AT1G09390 400 / 5e-139 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0264 [flax] [poplar] SGNH_hydrolase PF00657 [flax] [poplar] Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Representative CDS sequence Show only first row Show all	>Lus10029981 pacid=23159650 polypeptide=Lus10029981 locus=Lus10029981.g ID=Lus10029981.BGIv1.0 annot-version=v1.0 ATGGCTGCCAAGACCTCTCATCTCAGCATTACCATCATCATCCTACTATCCTGCCTATCTTATCCATCAACTTCAACAGACTTCAACTACCCGGCAGCTT TCAACTTCGGCGACTCAAACTCTGACACAGGAGACCTCATTGCTGGCCTAGGAATCCGACTCGGCCTACCTTATGGACAGACTTACTTCAACTCTCCATC TGGGAGGTTCTCCGATGGCCGCCTCATTCTCGACTTCCTGAGTAAAGATCCCTTCTTTGTCATATATCATATCATGAACAAAGCATATTCTGTAGACATG GGGTTAGAATCTTGA
AA sequence Show only first row Show all	>Lus10029981 pacid=23159650 polypeptide=Lus10029981 locus=Lus10029981.g ID=Lus10029981.BGIv1.0 annot-version=v1.0 MAAKTSHLSITIIILLSCLSYPSTSTDFNYPAAFNFGDSNSDTGDLIAGLGIRLGLPYGQTYFNSPSGRFSDGRLILDFLSKDPFFVIYHIMNKAYSVDM GLES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G54790			GDSL-like Lipase/Acylhydrolase...		Lus10029981 [exp]	0	1
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10042371 [exp]	3.0	0.9620
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Lus10007243 [exp]	3.2	0.9657
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Lus10028243 [exp]	4.0	0.9654
AT4G28380			Leucine-rich repeat (LRR) fami...		Lus10017713 [exp]	6.9	0.9273
AT1G23460			Pectin lyase-like superfamily ...		Lus10029139 [exp]	8.0	0.9464
					Lus10028069 [exp]	8.8	0.9452
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Lus10022729 [exp]	9.9	0.9379
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10032424 [exp]	9.9	0.9413
AT2G03500	GARP		Homeodomain-like superfamily p...		Lus10023857 [exp]	10.2	0.9446
AT3G49210			O-acyltransferase (WSD1-like) ...		Lus10033680 [exp]	10.7	0.9229

Compare expression of checked genes

Lus10029981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.