Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G57540 164 / 3e-54 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035345 [exp] 203 / 1e-69 AT1G57540 166 / 6e-55 unknown protein Lus10024000 [exp] 75 / 8e-18 AT1G57540 62 / 2e-12 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002900 [exp] 166 / 3e-55 AT1G57540 162 / 1e-53 unknown protein Potri.013G002301 [exp] 70 / 1e-17 AT1G57540 63 / 3e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029982 pacid=23159811 polypeptide=Lus10029982 locus=Lus10029982.g ID=Lus10029982.BGIv1.0 annot-version=v1.0 ATGTCGCTAAGACAATACTTGGGGTACTCGGAGGGAGAGCTGATGAGGTCGGACTGCAAGCCTTGCTCAAGGCTTATGAGGCATACAGCTGGGATCTTCA CCGTCGGTGGGGCTTTCGGGTTCTGGATTCTCTGCAGGCTTCATTACGGTCCCAGAGTTACCACGCCCAGGGCGCTACGGTGGGCGGCTACTGGAGCTTT GACAGTGAGCTCGTCGACGGCGTTGCTGGTCCGGATGTTTAGCCCGGAGTGCGAGCCGCAGAACATTGCTGCTTTTGACAAGCCTATGTCGTCGTAG
AA sequence Show only first row Show all	>Lus10029982 pacid=23159811 polypeptide=Lus10029982 locus=Lus10029982.g ID=Lus10029982.BGIv1.0 annot-version=v1.0 MSLRQYLGYSEGELMRSDCKPCSRLMRHTAGIFTVGGAFGFWILCRLHYGPRVTTPRALRWAATGALTVSSSTALLVRMFSPECEPQNIAAFDKPMSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G57540			unknown protein		Lus10029982 [exp]	0	1
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10037505 [exp]	3.7	0.7374
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10022670 [exp]	8.1	0.7275
AT3G63090			Ubiquitin carboxyl-terminal hy...		Lus10012374 [exp]	11.0	0.6979
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	14.2	0.7247
AT2G21290			unknown protein		Lus10018053 [exp]	14.8	0.7208
AT4G17370			Oxidoreductase family protein ...		Lus10007490 [exp]	23.9	0.6854
AT5G52630		MEF1	mitochondrial RNAediting facto...		Lus10012206 [exp]	28.9	0.6765
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Lus10017668 [exp]	29.5	0.7225
AT4G10620			P-loop containing nucleoside t...		Lus10000122 [exp]	30.0	0.6556
AT2G47890	CO	COL13	B-box type zinc finger protein...		Lus10005936 [exp]	31.1	0.7008

Compare expression of checked genes

Lus10029982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.