Lus10029991 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05000 294 / 1e-101 AtPFA-DSP1 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
AT4G03960 265 / 2e-90 AtPFA-DSP4 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT2G32960 266 / 6e-90 AtPFA-DSP2 plant and fungi atypical dual-specificity phosphatase 2, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT3G02800 207 / 9e-68 AtPFA-DSP3 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
AT5G16480 199 / 2e-64 AtPFA-DSP5 plant and fungi atypical dual-specificity phosphatase 5, Phosphotyrosine protein phosphatases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035333 442 / 9e-160 AT1G05000 291 / 2e-100 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10031529 323 / 4e-113 AT1G05000 304 / 2e-106 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10015154 316 / 7e-110 AT1G05000 298 / 3e-103 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G159100 312 / 1e-108 AT1G05000 310 / 3e-108 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.002G224000 306 / 1e-106 AT1G05000 300 / 9e-105 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.004G002800 280 / 2e-96 AT1G05000 286 / 4e-99 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.011G021100 280 / 3e-96 AT4G03960 288 / 4e-100 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
Potri.013G086500 205 / 1e-66 AT3G02800 296 / 2e-103 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF03162 Y_phosphatase2 Tyrosine phosphatase family
Representative CDS sequence
>Lus10029991 pacid=23159798 polypeptide=Lus10029991 locus=Lus10029991.g ID=Lus10029991.BGIv1.0 annot-version=v1.0
ATGAAACTGGATCGCGATTTTCCGGCCGCCGCCGGAAAACTACACCAGCAGCAGCAGAATCAAGACAAAGGTGAAAAAATTAGCGCCGAGGAAGAGATGT
GCAAGACGATCGAAGTCGCTACCTTCATTGACTACCACCACCACCACCGCCGCCGGCTGAAAATTCAGCCGGAGCTATACTCGTCGCCGGTTGATGTCGT
CGTCGTCGGAGATGATCACGAATTGAGTCTCCTCCCTCCGTTAAATTTCGCGATGGTTGATAGCGGTATATTCCGGTCCGGATTCCCCAATTCCACCAAC
TTCTCCTTCGTCCAGACTCTCGGCCTCCGGTCAATCATATGCATGTGTCCGGAGCCATATCCGGAGGCGAACGCGGAGTTTCTCAAGGAGAATGGGATTA
GGCTGTTCCAGTTCGGAATCGAAGGTTACAAGGAACCATTCGTAAACATTCCCGACGACATGATTCGAGAAGCTCTAAAAGTAGTCCTTGATGTGAAGAA
CCACCCGATCCTGATCCACTGCAAGCGAGGCAAGCATCGAACGGGGTGCGTGGTGGGGTGCCTGAGGAAGCTGCAGAAATGGTGCTTGTCGTCGATATTC
GACGAGTACTCGAGGTTTGCTGCGGCCAAGGCTAGAGTGTCGGACCAAAGGTTCATGGAGTTGTTTGACGTTTCTACCTTGACGCATTTGCCTATGCCAT
TTTCCTGCTCCAGTTTTTCCAAGGAGTAG
AA sequence
>Lus10029991 pacid=23159798 polypeptide=Lus10029991 locus=Lus10029991.g ID=Lus10029991.BGIv1.0 annot-version=v1.0
MKLDRDFPAAAGKLHQQQQNQDKGEKISAEEEMCKTIEVATFIDYHHHHRRRLKIQPELYSSPVDVVVVGDDHELSLLPPLNFAMVDSGIFRSGFPNSTN
FSFVQTLGLRSIICMCPEPYPEANAEFLKENGIRLFQFGIEGYKEPFVNIPDDMIREALKVVLDVKNHPILIHCKRGKHRTGCVVGCLRKLQKWCLSSIF
DEYSRFAAAKARVSDQRFMELFDVSTLTHLPMPFSCSSFSKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05000 AtPFA-DSP1 plant and fungi atypical dual-... Lus10029991 0 1
AT2G32240 unknown protein Lus10003812 3.7 0.8523
AT2G22250 ATAAT, AAT, MEE... MATERNAL EFFECT EMBRYO ARREST ... Lus10032388 4.9 0.8536
AT5G03540 ATEXO70A1 exocyst subunit exo70 family p... Lus10043432 9.5 0.8171
AT2G30340 AS2 LBD13 LOB domain-containing protein ... Lus10009930 10.2 0.8398
AT1G13940 Plant protein of unknown funct... Lus10021644 16.5 0.7851
AT2G43160 ENTH/VHS family protein (.1.2.... Lus10026741 20.8 0.8097
AT5G46630 Clathrin adaptor complexes med... Lus10030961 21.4 0.8049
AT2G31390 STH pfkB-like carbohydrate kinase ... Lus10009526 26.7 0.8515
AT5G22350 ELM1 ELONGATED MITOCHONDRIA 1, Prot... Lus10005191 28.4 0.8105
AT4G11740 SAY1 Ubiquitin-like superfamily pro... Lus10029591 37.1 0.8234

Lus10029991 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.