Lus10029997 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44950 44 / 2e-05 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT3G52680 44 / 2e-05 F-box/RNI-like/FBD-like domains-containing protein (.1.2)
AT3G29830 42 / 0.0001 F-box/RNI-like superfamily protein (.1)
AT5G53840 42 / 0.0001 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G22660 41 / 0.0001 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
AT5G22720 41 / 0.0002 F-box/RNI-like superfamily protein (.1.2)
AT2G04230 41 / 0.0002 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT5G44980 41 / 0.0002 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT4G03220 40 / 0.0002 Protein with RNI-like/FBD-like domains (.1)
AT1G16930 40 / 0.0003 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030031 74 / 3e-17 AT2G04230 53 / 4e-09 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Lus10035326 74 / 1e-16 AT5G27750 66 / 1e-12 F-box/FBD-like domains containing protein (.1)
Lus10029986 75 / 5e-16 AT1G20920 347 / 2e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10029953 67 / 1e-13 AT5G03100 66 / 3e-12 F-box/RNI-like superfamily protein (.1)
Lus10029999 61 / 7e-13 ND 37 / 4e-04
Lus10035308 62 / 4e-12 AT5G22730 57 / 2e-09 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10037440 63 / 5e-12 AT1G69630 84 / 5e-17 F-box/RNI-like superfamily protein (.1)
Lus10029952 63 / 5e-12 AT5G03100 68 / 1e-12 F-box/RNI-like superfamily protein (.1)
Lus10027507 62 / 1e-11 AT1G01580 475 / 1e-152 FERRIC CHELATE REDUCTASE DEFECTIVE 1, ferric reduction oxidase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G104100 50 / 2e-07 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.001G395000 49 / 4e-07 AT4G14103 89 / 4e-19 F-box/RNI-like superfamily protein (.1.2)
Potri.011G104300 48 / 6e-07 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
Potri.011G104200 48 / 8e-07 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.015G002001 44 / 2e-05 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Potri.001G337200 43 / 4e-05 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Potri.017G146500 42 / 0.0001 AT5G02920 64 / 2e-11 F-box/RNI-like superfamily protein (.1)
Potri.017G146400 42 / 0.0001 AT3G28410 79 / 2e-15 F-box/RNI-like superfamily protein (.1)
Potri.015G002100 41 / 0.0002 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.015G011200 40 / 0.0003 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
PFAM info
Representative CDS sequence
>Lus10029997 pacid=23159674 polypeptide=Lus10029997 locus=Lus10029997.g ID=Lus10029997.BGIv1.0 annot-version=v1.0
ATGACTAATCTAAGCCCAGTTGGAATCCGTAACAAATTAGAAACAGCCGCCGCCTCACTGAATCATTCGACCTTGGCCCCTTCGATGGCGAACCAATCGA
CCCCAGCCGGCGAAGATCGGATCTCAGAATTGCCGGATGGAATTCTCCACTGCATCTTAGGCCGGTTAGACAACTCCAAACAATCAACGCAGACTGTAAT
CCTGTCCAAGCGATGGCGAAGCATCTGCGAGTCGTACCCTATCGTCGAATTCCACCCTGCGATGCGAATCATACGATCATCTCGATGGAGATATTTTGCT
CGGTTCGCGAAACCGCAGGTGGAAACCCTAGAACTCGAAGATAATTTTTCAAGCTTGATGAAAATCCACGTTCCTCGCGACTTTGCTTCCGCACCCGAAG
GCGATGCAACTCTCGTTTTCTCACGACTTGGAAATCGAAGATATTGCAGCTCGTGGATTAGAAACTCTGCGAATTTCAGACGAATATTCTAG
AA sequence
>Lus10029997 pacid=23159674 polypeptide=Lus10029997 locus=Lus10029997.g ID=Lus10029997.BGIv1.0 annot-version=v1.0
MTNLSPVGIRNKLETAAASLNHSTLAPSMANQSTPAGEDRISELPDGILHCILGRLDNSKQSTQTVILSKRWRSICESYPIVEFHPAMRIIRSSRWRYFA
RFAKPQVETLELEDNFSSLMKIHVPRDFASAPEGDATLVFSRLGNRRYCSSWIRNSANFRRIF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52680 F-box/RNI-like/FBD-like domain... Lus10029997 0 1
Lus10006316 1.0 0.9047
AT3G13898 unknown protein Lus10008387 17.0 0.8780
AT1G49410 TOM6 translocase of the outer mitoc... Lus10007383 21.1 0.8683
AT5G63135 unknown protein Lus10019491 24.2 0.8324
AT5G41010 NRPE12, NRPD12,... DNA directed RNA polymerase, 7... Lus10007891 25.5 0.8253
AT2G18960 OST2, PMA, AHA1 PLASMA MEMBRANE PROTON ATPASE,... Lus10028202 31.0 0.7440
AT2G27990 HD PNF, BLH8 POUND-FOOLISH, BEL1-like homeo... Lus10040256 31.2 0.8650
AT5G23570 SGS3, ATSGS3 SUPPRESSOR OF GENE SILENCING 3... Lus10026697 31.6 0.8609
Lus10038209 37.2 0.8601
AT2G48020 Major facilitator superfamily ... Lus10027977 38.4 0.8593

Lus10029997 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.