Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49040 38 / 0.0001 F-box/RNI-like superfamily protein (.1) AT5G02920 37 / 0.0003 F-box/RNI-like superfamily protein (.1) AT5G22660 36 / 0.0007 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035325 [exp] 114 / 3e-34 AT5G02920 42 / 4e-05 F-box/RNI-like superfamily protein (.1) Lus10003943 [exp] 68 / 5e-15 AT3G59160 50 / 1e-06 F-box/RNI-like superfamily protein (.1) Lus10029997 [exp] 61 / 5e-13 AT3G52680 44 / 1e-05 F-box/RNI-like/FBD-like domains-containing protein (.1.2) Lus10025675 [exp] 49 / 5e-09 AT5G53840 45 / 1e-06 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10042272 [exp] 51 / 6e-09 AT4G03220 65 / 4e-11 Protein with RNI-like/FBD-like domains (.1) Lus10027507 [exp] 48 / 7e-08 AT1G01580 475 / 1e-152 FERRIC CHELATE REDUCTASE DEFECTIVE 1, ferric reduction oxidase 2 (.1) Lus10035326 [exp] 47 / 9e-08 AT5G27750 66 / 1e-12 F-box/FBD-like domains containing protein (.1) Lus10028664 [exp] 47 / 1e-07 AT5G50260 59 / 6e-09 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10018543 [exp] 47 / 1e-07 AT1G03510 534 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G104200 [exp] 39 / 8e-05 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.011G104300 [exp] 39 / 9e-05 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1) Potri.011G104100 [exp] 39 / 9e-05 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.012G099400 [exp] 37 / 0.0004 AT5G44950 77 / 1e-14 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.015G002100 [exp] 37 / 0.0004 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1) Potri.017G146500 [exp] 37 / 0.0004 AT5G02920 64 / 2e-11 F-box/RNI-like superfamily protein (.1) Potri.015G011200 [exp] 37 / 0.0005 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029999 pacid=23159686 polypeptide=Lus10029999 locus=Lus10029999.g ID=Lus10029999.BGIv1.0 annot-version=v1.0 ATGGCCACCGCCGCTGCTAACTCCGGCCAGGAAGGAGAAGACCGAATCTCGACGTTACAGGACGAGATCATCCATGAGATCCTCGATCGCCTAGAGTCCC GACGGCAGGTTACACAATTCAACATCCTGTCCAAAAGATGGTCCCATCTCATTCAGTCTTATCTTCTGGAATTCCACGAAAGCTGGAGACAATCGATCAG TGGCGATGGAAATCGATGCATCCAAGTTGACTAA
AA sequence Show only first row Show all	>Lus10029999 pacid=23159686 polypeptide=Lus10029999 locus=Lus10029999.g ID=Lus10029999.BGIv1.0 annot-version=v1.0 MATAAANSGQEGEDRISTLQDEIIHEILDRLESRRQVTQFNILSKRWSHLIQSYLLEFHESWRQSISGDGNRCIQVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029999 [exp]	0	1
					Lus10013898 [exp]	11.1	0.6897
					Lus10022573 [exp]	15.4	0.6812
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001431 [exp]	18.8	0.6812
					Lus10003840 [exp]	21.7	0.6812
AT5G65550			UDP-Glycosyltransferase superf...		Lus10026411 [exp]	22.4	0.6032
					Lus10006661 [exp]	24.3	0.6812
AT5G67210		IRX15-L	IRX15-LIKE, Protein of unknown...		Lus10009378 [exp]	26.6	0.6812
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10038264 [exp]	28.7	0.6812
					Lus10012429 [exp]	30.7	0.6812
AT3G05950			RmlC-like cupins superfamily p...		Lus10029010 [exp]	32.6	0.6812

Compare expression of checked genes

Lus10029999 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.