Lus10030017 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32650 192 / 4e-64 RmlC-like cupins superfamily protein (.1.2)
AT2G32180 192 / 5e-64 PTAC18 plastid transcriptionally active 18 (.1)
AT4G10300 64 / 8e-14 RmlC-like cupins superfamily protein (.1)
AT4G10290 59 / 5e-12 RmlC-like cupins superfamily protein (.1)
AT4G10280 54 / 5e-10 RmlC-like cupins superfamily protein (.1)
AT3G04300 52 / 1e-09 RmlC-like cupins superfamily protein (.1)
AT2G27402 37 / 0.0002 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035307 255 / 7e-89 AT2G32180 190 / 2e-63 plastid transcriptionally active 18 (.1)
Lus10035660 64 / 2e-13 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1)
Lus10037245 63 / 4e-13 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1)
Lus10035659 62 / 9e-13 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156900 195 / 4e-65 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
Potri.013G089600 69 / 2e-15 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1)
Potri.002G254800 47 / 2e-07 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF05899 Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence
>Lus10030017 pacid=23159856 polypeptide=Lus10030017 locus=Lus10030017.g ID=Lus10030017.BGIv1.0 annot-version=v1.0
ATGGCAAGTTTGACAGCTTCACCAAACATAAGCTTCTTATCATCAGCCAGCAGCAGAACCGATCCCAAGAAGAATCTGAGCTCATTTCGAACAAATCGAT
GTTTCAGAGCGAGAGCATCAGCAGTGCAGGCGGTGAAGTCGCTTGAAGAGCTCTACAATGTGAGGGTGGAGAGGAAGGTGCCACCTCAGCGATTGGCTGA
GCTTGGTGTTTCGAGATGGTCGGTTTGGAAGACCGGCAAGTCCAAGCTGCCGTGGGATTGGCATGTAGACCAGTTGGTCTACATCGAAGAAGGTGAAGTC
AGGGTTGTCCCCGAAGGAAGCAAGCGGTACATGCAGTTCGTGGCTGGTGACCTCGTTCGTTACCCTAAATGGTTCGAGGCTGATCTCTGGTTCAATGGTC
CGTACCAGGAGCGTTACAGCTTCCGTGCTTATGGTGATGACTAG
AA sequence
>Lus10030017 pacid=23159856 polypeptide=Lus10030017 locus=Lus10030017.g ID=Lus10030017.BGIv1.0 annot-version=v1.0
MASLTASPNISFLSSASSRTDPKKNLSSFRTNRCFRARASAVQAVKSLEELYNVRVERKVPPQRLAELGVSRWSVWKTGKSKLPWDWHVDQLVYIEEGEV
RVVPEGSKRYMQFVAGDLVRYPKWFEADLWFNGPYQERYSFRAYGDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32180 PTAC18 plastid transcriptionally acti... Lus10030017 0 1
AT2G32180 PTAC18 plastid transcriptionally acti... Lus10035307 1.0 0.9550
AT5G14910 Heavy metal transport/detoxifi... Lus10032167 8.1 0.9492
AT2G38140 PSRP4 plastid-specific ribosomal pro... Lus10004829 8.9 0.9322
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Lus10029120 9.2 0.9513
AT5G08250 Cytochrome P450 superfamily pr... Lus10013438 9.8 0.9240
AT2G38140 PSRP4 plastid-specific ribosomal pro... Lus10002497 10.7 0.9482
AT2G19740 Ribosomal protein L31e family ... Lus10025830 10.8 0.9034
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10022110 11.7 0.9485
AT2G01755 unknown protein Lus10030691 12.0 0.9343
Lus10008697 12.0 0.9315

Lus10030017 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.