Lus10030025 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21610 175 / 2e-55 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT1G67600 153 / 6e-47 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 148 / 9e-45 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G61770 92 / 4e-22 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 54 / 1e-08 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035299 222 / 2e-73 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10000883 162 / 1e-50 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 162 / 4e-50 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10011373 137 / 1e-40 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10006432 136 / 4e-40 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 120 / 1e-34 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10030253 96 / 1e-24 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10014550 52 / 6e-09 AT3G61770 115 / 4e-33 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 49 / 1e-06 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156000 179 / 9e-57 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 178 / 1e-56 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.011G087100 166 / 6e-52 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.010G056600 147 / 3e-44 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.002G171300 91 / 3e-21 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 52 / 9e-08 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10030025 pacid=23159756 polypeptide=Lus10030025 locus=Lus10030025.g ID=Lus10030025.BGIv1.0 annot-version=v1.0
ATGGACGAGGTGATGACCACCGCCGACGCGACATTGGGAAGAGCGGCGCTGAAAATGGCCAGGACGGCTTCGTCGTCGATCCTCTCCACTCCGACGCCTC
CGTCCTCTTCTCCTCCTTTGTTGTTGTTGCCGAGCAACCTCCCACTGATCTCGGCCTTCCTCGCCTTCGCCCTCGCCCAGTTCCTCAAGCTCTTCACCAA
TTGGTTTAAGGAGAAGAGATGGGATTCCAAGAGGATGGTGGACTCCGGTGGGATGCCGTCTTCGCATTCCGCAACAGTGACAGCGCTCGCTATGGCTATT
GGATTGCAGGAAGGGACTGGATCCCCTGCTTTCGCCATTGCTGTTGTCCTTGCTTTCGTTGTTATGTATGATGCATCTGGGATCAGACTTCACGCTGGCC
GTCAAGCTGAATTGCTGAACCAAATTATGTGTGAGTTTCCGCCAGAACACCCCTTATCCAGTGTGAGACCTTTGCGCGAGTTACTTGGACACACTCCATT
CCAGCCGGAACTTGATGCAGGTCGTTGTCGGAGCAATGTTGGGATGCATGGTATCTTACCTGATGAGAAACACCGACTAACATCAGAAGTACCGGTTGAA
TCCTTCACCGATTTGCAAGGAAACACAGCACTCGTTCCCACGGGAGCTTCTCAAGTAGTAGTGAGGCAAGGGGAAAGGGAAAGACCTAATGTAATACTTA
GAACACCAAAACTTCGAAAAATCTTTACCGTCTCGTAA
AA sequence
>Lus10030025 pacid=23159756 polypeptide=Lus10030025 locus=Lus10030025.g ID=Lus10030025.BGIv1.0 annot-version=v1.0
MDEVMTTADATLGRAALKMARTASSSILSTPTPPSSSPPLLLLPSNLPLISAFLAFALAQFLKLFTNWFKEKRWDSKRMVDSGGMPSSHSATVTALAMAI
GLQEGTGSPAFAIAVVLAFVVMYDASGIRLHAGRQAELLNQIMCEFPPEHPLSSVRPLRELLGHTPFQPELDAGRCRSNVGMHGILPDEKHRLTSEVPVE
SFTDLQGNTALVPTGASQVVVRQGERERPNVILRTPKLRKIFTVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21610 Acid phosphatase/vanadium-depe... Lus10030025 0 1
AT5G01970 unknown protein Lus10031947 1.7 0.8737
AT1G78680 ATGGH2 gamma-glutamyl hydrolase 2 (.1... Lus10028143 2.8 0.8628
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10035419 4.6 0.8524
AT4G25150 HAD superfamily, subfamily III... Lus10007939 5.0 0.8627
Lus10015401 10.8 0.8716
AT4G28400 Protein phosphatase 2C family ... Lus10039853 11.2 0.8447
AT5G41560 unknown protein Lus10028758 14.1 0.8319
AT3G50150 Plant protein of unknown funct... Lus10039780 14.3 0.8348
AT1G04960 Protein of unknown function (D... Lus10014626 14.5 0.8417
AT4G28880 CKL3 casein kinase I-like 3 (.1) Lus10043233 19.9 0.8342

Lus10030025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.