Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037440 [exp] 74 / 2e-16 AT1G69630 84 / 5e-17 F-box/RNI-like superfamily protein (.1) Lus10029953 [exp] 68 / 2e-14 AT5G03100 66 / 3e-12 F-box/RNI-like superfamily protein (.1) Lus10027507 [exp] 66 / 2e-13 AT1G01580 475 / 1e-152 FERRIC CHELATE REDUCTASE DEFECTIVE 1, ferric reduction oxidase 2 (.1) Lus10035326 [exp] 62 / 7e-13 AT5G27750 66 / 1e-12 F-box/FBD-like domains containing protein (.1) Lus10029952 [exp] 63 / 9e-13 AT5G03100 68 / 1e-12 F-box/RNI-like superfamily protein (.1) Lus10035308 [exp] 55 / 4e-10 AT5G22730 57 / 2e-09 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10029997 [exp] 54 / 4e-10 AT3G52680 44 / 1e-05 F-box/RNI-like/FBD-like domains-containing protein (.1.2) Lus10027471 [exp] 55 / 8e-10 AT5G22730 55 / 2e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10018543 [exp] 49 / 1e-07 AT1G03510 534 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030031 pacid=23159665 polypeptide=Lus10030031 locus=Lus10030031.g ID=Lus10030031.BGIv1.0 annot-version=v1.0 ATGGAGGAATCGGAAGCCTCCGCCGCCGTCGAAGATCGAATCTCAGGATTGCCGGATGGAATCCTCCACTGCATCCTCCGCCGCTTGCCGTCCCAAGAAC AAGCGGCACAGTCCATCACCCTGTCTAGGCGATGGAGAAGTCTCTGGCGGTCCTACCCGATTGTGGAGTACGACTGCCATATTCGCAACCGCCGCCAAGA TCTCCGGAAATTCGGCGACGCAACCATCCAGAGGTTTTCGGCTCTCGATAGCCTTTTCCGGATTGAAATTCTGCAACTCCGGCTACAATTAGACGAACGA TGTTTCTCCCATTCGCCGTCGCCACTTGTGATCAGCTGCAAGCTGTAG
AA sequence Show only first row Show all	>Lus10030031 pacid=23159665 polypeptide=Lus10030031 locus=Lus10030031.g ID=Lus10030031.BGIv1.0 annot-version=v1.0 MEESEASAAVEDRISGLPDGILHCILRRLPSQEQAAQSITLSRRWRSLWRSYPIVEYDCHIRNRRQDLRKFGDATIQRFSALDSLFRIEILQLRLQLDER CFSHSPSPLVISCKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G04230			FBD, F-box and Leucine Rich Re...		Lus10030031 [exp]	0	1
					Lus10042238 [exp]	5.7	0.7486
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10031852 [exp]	9.8	0.7431
AT1G52190			Major facilitator superfamily ...		Lus10008539 [exp]	11.9	0.7344
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	14.6	0.7335
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	16.3	0.7335
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	17.1	0.7329
AT1G02030	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10031166 [exp]	17.2	0.7149
					Lus10034069 [exp]	18.5	0.7231
AT3G10660		ATCPK2, CPK2	calmodulin-domain protein kina...		Lus10016190 [exp]	22.0	0.7116
					Lus10011637 [exp]	22.6	0.7148

Compare expression of checked genes

Lus10030031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.