Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31130 106 / 2e-30 Protein of unknown function (DUF1218) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014344 [exp] 112 / 8e-33 AT4G31130 292 / 7e-102 Protein of unknown function (DUF1218) (.1) Lus10026052 [exp] 110 / 6e-32 AT4G31130 287 / 6e-100 Protein of unknown function (DUF1218) (.1) Lus10004839 [exp] 43 / 6e-06 ND 44 / 1e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G000600 [exp] 100 / 5e-28 AT4G31130 277 / 4e-96 Protein of unknown function (DUF1218) (.1) Potri.006G280900 [exp] 97 / 9e-27 AT4G31130 253 / 2e-86 Protein of unknown function (DUF1218) (.1) Potri.007G002900 [exp] 71 / 3e-16 AT4G31130 179 / 4e-57 Protein of unknown function (DUF1218) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030038 pacid=23159702 polypeptide=Lus10030038 locus=Lus10030038.g ID=Lus10030038.BGIv1.0 annot-version=v1.0 ATGGCAGTCACCATGAAGCTGATGTCACTGATCGTCGCCACCCTCGGCGCCTTATCGTTCATCTTCGGCATTGTGGCTGAGAACAAGAAGCCGGCAGAAG GGGTCCCGATCACCGGGAAGGGAGTGGTGATATGCAAGTATCCGTCGGATCCGACGGTGGCGCTGGGATACTTGTCGGTTGCGTTTATGTTCGCGGCCGG CGGTGGTTGGCTATGTCTCGTTGTTTTATCCTTACAAGGGGAAGTCCGTTCCGCAGTCTGCTATGTTTAG
AA sequence Show only first row Show all	>Lus10030038 pacid=23159702 polypeptide=Lus10030038 locus=Lus10030038.g ID=Lus10030038.BGIv1.0 annot-version=v1.0 MAVTMKLMSLIVATLGALSFIFGIVAENKKPAEGVPITGKGVVICKYPSDPTVALGYLSVAFMFAAGGGWLCLVVLSLQGEVRSAVCYV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31130			Protein of unknown function (D...		Lus10030038 [exp]	0	1
AT4G31130			Protein of unknown function (D...		Lus10030037 [exp]	1.0	0.8844
AT4G40060	HD	ATHB16 ,ATHB-16	homeobox protein 16 (.1)		Lus10012753 [exp]	12.0	0.7241
AT2G37570		SLT1	sodium- and lithium-tolerant 1...		Lus10024406 [exp]	12.4	0.7531
AT1G67570			Protein of unknown function (D...		Lus10006430 [exp]	17.0	0.7272
AT4G31270	Trihelix		sequence-specific DNA binding ...		Lus10026986 [exp]	17.3	0.7330
AT2G02230		ATPP2-B1	phloem protein 2-B1 (.1)		Lus10042713 [exp]	17.7	0.7246
AT5G07920		ATDGK1, DGK1	DIACYLGLYCEROL KINASE 1, diacy...		Lus10034702 [exp]	18.4	0.7565
AT4G04955		ATALN	allantoinase (.1)		Lus10025648 [exp]	19.8	0.6943
AT1G67570			Protein of unknown function (D...		Lus10011371 [exp]	21.0	0.7089
AT3G05010			Protein of unknown function, t...		Lus10033835 [exp]	28.1	0.7482

Compare expression of checked genes

Lus10030038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.