Lus10030043 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42570 209 / 4e-69 B-cell receptor-associated 31-like (.1)
AT1G11905 161 / 4e-50 B-cell receptor-associated protein 31-like (.1.2)
AT5G48660 110 / 2e-30 B-cell receptor-associated protein 31-like (.1)
AT3G07190 98 / 1e-25 B-cell receptor-associated protein 31-like (.1)
AT3G20450 93 / 2e-24 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035283 289 / 7e-101 AT5G42570 244 / 9e-83 B-cell receptor-associated 31-like (.1)
Lus10031546 234 / 1e-78 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1)
Lus10015132 210 / 3e-69 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1)
Lus10020025 168 / 7e-53 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10011842 118 / 2e-33 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10038188 109 / 1e-29 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Lus10022777 108 / 2e-29 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G007900 196 / 9e-64 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1)
Potri.011G007200 194 / 3e-63 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1)
Potri.014G154800 156 / 2e-48 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
Potri.014G191500 135 / 6e-40 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.002G245300 123 / 3e-35 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
Potri.011G089100 120 / 5e-35 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05529 Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence
>Lus10030043 pacid=23159745 polypeptide=Lus10030043 locus=Lus10030043.g ID=Lus10030043.BGIv1.0 annot-version=v1.0
ATGATACAGCTTCTATACGGAGTGATCTTCGGCCAGATGGTGTTGATCCTGTTGCTGCTGTTCAAGACGCCGCTGCGGAAGCTGGTTATCATGGCCTTGG
ATCGGCTCAAGCGAGGGAGAGGTCCCATCGTTGTGAAAACTGTCTCCGGAACGCTCCTGCTGGTACTTTTCTCCAGCCTTTACAGTATGTTCACGATTCA
GAATCGCTCCATCGAGGCCGGTGCTCCCAATCCTACCGACCAGGTCCTCATGTCCCGCCACCTCCTCGAAGCCTCTCTCATGGGATTTGTGCTGTTCCTT
TCGCTGATGATCGACAGGCTACACCACTACATCAGGGAGCTTCGCCAGCTAAGGAAGACAATGGAGACCGCCAAGAAACACACTCGAGGAGTAGACGATA
CCAAAACCACCAGCAGCAGCAACTCAGAAGAGATGAAAGCACTCGAAGAAGAAGCTGCTTCTCTACGCAGTAAAGTGAAGCAGCTGGAAGCCGAATGTGA
AGCCAAGACCAATGAAATCAAAGCTGCAGAAGAGATATTCGAGCCCAAGAAGGACATGTAA
AA sequence
>Lus10030043 pacid=23159745 polypeptide=Lus10030043 locus=Lus10030043.g ID=Lus10030043.BGIv1.0 annot-version=v1.0
MIQLLYGVIFGQMVLILLLLFKTPLRKLVIMALDRLKRGRGPIVVKTVSGTLLLVLFSSLYSMFTIQNRSIEAGAPNPTDQVLMSRHLLEASLMGFVLFL
SLMIDRLHHYIRELRQLRKTMETAKKHTRGVDDTKTTSSSNSEEMKALEEEAASLRSKVKQLEAECEAKTNEIKAAEEIFEPKKDM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42570 B-cell receptor-associated 31-... Lus10030043 0 1
AT4G00300 fringe-related protein (.1.2) Lus10018823 3.7 0.9291
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Lus10033420 5.7 0.9209
AT3G19830 NTMCTYPE5.2 ,NT... Calcium-dependent lipid-bindin... Lus10034197 6.0 0.8750
AT1G19210 AP2_ERF Integrase-type DNA-binding sup... Lus10034885 6.0 0.9185
AT3G18930 RING/U-box superfamily protein... Lus10012033 8.5 0.8948
AT4G29780 unknown protein Lus10011946 10.6 0.9173
AT1G01260 bHLH bHLH013, INU4 basic helix-loop-helix (bHLH) ... Lus10005966 11.2 0.8797
AT4G29780 unknown protein Lus10027622 11.6 0.9128
AT1G74450 Protein of unknown function (D... Lus10042809 12.7 0.8881
AT5G47390 MYB myb-like transcription factor ... Lus10004384 14.9 0.9044

Lus10030043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.