Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008397 [exp] 103 / 6e-30 ND / Lus10032696 [exp] 103 / 6e-30 ND / Lus10001874 [exp] 106 / 2e-29 ND / Lus10025298 [exp] 95 / 1e-26 ND / Lus10033028 [exp] 90 / 4e-23 ND / Lus10007680 [exp] 87 / 5e-23 ND / Lus10025155 [exp] 86 / 7e-23 ND / Lus10036300 [exp] 82 / 2e-21 ND / Lus10039431 [exp] 81 / 3e-20 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030050 pacid=23172587 polypeptide=Lus10030050 locus=Lus10030050.g ID=Lus10030050.BGIv1.0 annot-version=v1.0 ATGAAGATCCCAGCTGAGGCCATCCTCCGGACCGTGTACTATCGTCATCCTGTGGTGACCGGTGATACTATTGCTGGGTACTGTCTCCAATTGTGCACCG ATGAAGAGTCTTGGGGAGCCGTTAACTACATGAACGTTGATGAGGTCTCACAGTCCGGCGTACAACCCACCGCTGATGTCGTGGATGAAGAAGACGTTGA CAACGAGTTTGAGTACGATCCGACTAACAACAATGGGGAAGAGGAAGATGACCAGGTCTCGAGTGAGGACGACGACGGTACGCCGATTGGCCCTCTCCGT CCAGAGGGGGGATGCTGA
AA sequence Show only first row Show all	>Lus10030050 pacid=23172587 polypeptide=Lus10030050 locus=Lus10030050.g ID=Lus10030050.BGIv1.0 annot-version=v1.0 MKIPAEAILRTVYYRHPVVTGDTIAGYCLQLCTDEESWGAVNYMNVDEVSQSGVQPTADVVDEEDVDNEFEYDPTNNNGEEEDDQVSSEDDDGTPIGPLR PEGGC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030050 [exp]	0	1
AT1G02010		SEC1A	secretory 1A (.1.2)		Lus10015870 [exp]	2.0	0.7656
AT5G04347			Plant self-incompatibility pro...		Lus10016171 [exp]	3.6	0.8242
AT1G09080		BIP3	binding protein 3, Heat shock ...		Lus10031206 [exp]	6.5	0.6992
					Lus10022175 [exp]	11.4	0.7179
AT5G65550			UDP-Glycosyltransferase superf...		Lus10043445 [exp]	13.5	0.7481
AT2G25680		MOT1	molybdate transporter 1 (.1)		Lus10019046 [exp]	16.1	0.6777
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10042370 [exp]	19.3	0.7318
AT1G02010		SEC1A	secretory 1A (.1.2)		Lus10009293 [exp]	20.5	0.6405
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	26.4	0.7175
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	28.5	0.7175

Compare expression of checked genes

Lus10030050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.