Lus10030052 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25940 73 / 7e-18 early nodulin-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033027 162 / 2e-53 AT5G25940 69 / 2e-16 early nodulin-related (.1)
Lus10019434 142 / 3e-45 AT5G25940 75 / 8e-19 early nodulin-related (.1)
Lus10043290 140 / 1e-44 AT5G25940 76 / 3e-19 early nodulin-related (.1)
Lus10002236 58 / 3e-12 AT5G25940 82 / 3e-21 early nodulin-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G184000 143 / 1e-45 AT5G25940 74 / 4e-18 early nodulin-related (.1)
Potri.009G143800 132 / 3e-41 AT5G25940 65 / 1e-14 early nodulin-related (.1)
Potri.019G033700 80 / 2e-20 AT5G25940 68 / 1e-15 early nodulin-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03386 ENOD93 Early nodulin 93 ENOD93 protein
Representative CDS sequence
>Lus10030052 pacid=23172628 polypeptide=Lus10030052 locus=Lus10030052.g ID=Lus10030052.BGIv1.0 annot-version=v1.0
ATGGCAAAGAATGTGGCTCAATCGACTTGCAGCAGCAGCATGGCTTCACTTGACCAAAGGTTGGCAATGGCAAAGCGTTGTTCTCATGAGGGAGTGGTTG
CTGGAGCAAAGGCAGCAGTAGTTGCCAGCATAGCTGCTGCCATTCCAACACTTGCAAGTGCAAGGATGCTTCCATGGGCAAGAGCTAATCTCAATCACAC
TGCACAAGCTCTCATTATCTCCACAGTTGCTGGAGCAGCCTATTTTATTGTTGCTGACAAGACTGTCCTAGCTACAGCAAGAAAGAACTCATTCAAAGAT
ATTTCTAACAACTGA
AA sequence
>Lus10030052 pacid=23172628 polypeptide=Lus10030052 locus=Lus10030052.g ID=Lus10030052.BGIv1.0 annot-version=v1.0
MAKNVAQSTCSSSMASLDQRLAMAKRCSHEGVVAGAKAAVVASIAAAIPTLASARMLPWARANLNHTAQALIISTVAGAAYFIVADKTVLATARKNSFKD
ISNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25940 early nodulin-related (.1) Lus10030052 0 1
AT3G50390 Transducin/WD40 repeat-like su... Lus10016779 1.4 0.9885
Lus10026740 3.0 0.9757
AT3G48660 Protein of unknown function (D... Lus10003120 3.0 0.9844
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10030534 3.2 0.9870
AT3G05550 Hypoxia-responsive family prot... Lus10033002 3.5 0.9732
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10038904 4.0 0.9841
AT3G14880 unknown protein Lus10042453 4.5 0.9755
AT3G59710 NAD(P)-binding Rossmann-fold s... Lus10034835 4.9 0.9788
AT5G39890 Protein of unknown function (D... Lus10003861 6.0 0.9805
Lus10002596 6.3 0.9809

Lus10030052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.