Lus10030066 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003946 52 / 5e-09 ND /
Lus10040045 52 / 9e-09 ND /
Lus10040052 47 / 2e-07 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10030066 pacid=23172537 polypeptide=Lus10030066 locus=Lus10030066.g ID=Lus10030066.BGIv1.0 annot-version=v1.0
ATGATGGGTTTGGGAGTTACCCCCATAATGCACTTTTTCATCATAATCTCCTTCAGCCTCTGGGCATGTGAGGTGTCGTCAAATGCTGCTCATAGTGCTC
CTCCTCCCATACGGGAAGAGTTTGAGCGGATGTCACATCGGATGGGGTTGACTTCAAAACATGTGGCTACAATGTATTCCATGATGTCGCAACATATCCC
TGATGCTTCTACTTCAGTTTTGACTTCTAGGAAAGTTTCAGGTACTCCATTCAATCCAAGTCGACATAGTTGTATTACGAGTCGGTGCAGCAGCAACAAC
CATCTCAGCAGCAGCAATAACCTCATGAGACCAATCATATGGGTCCCCATTCCGGACACGAGGGAGGAACGAGATGATGATGGTTCTTCATAG
AA sequence
>Lus10030066 pacid=23172537 polypeptide=Lus10030066 locus=Lus10030066.g ID=Lus10030066.BGIv1.0 annot-version=v1.0
MMGLGVTPIMHFFIIISFSLWACEVSSNAAHSAPPPIREEFERMSHRMGLTSKHVATMYSMMSQHIPDASTSVLTSRKVSGTPFNPSRHSCITSRCSSNN
HLSSSNNLMRPIIWVPIPDTREERDDDGSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030066 0 1
AT5G42170 SGNH hydrolase-type esterase s... Lus10003720 10.0 0.7332
AT1G52540 Protein kinase superfamily pro... Lus10001323 11.7 0.6541
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10003754 16.2 0.6961
Lus10032002 18.2 0.6297
AT5G48670 MADS FEM111, AGL80 AGAMOUS-like 80 (.1) Lus10014883 18.7 0.5896
AT3G13890 MYB ATMYB26, MS35 MALE STERILE 35, myb domain pr... Lus10015608 20.7 0.6292
AT3G20190 Leucine-rich repeat protein ki... Lus10034795 25.8 0.6028
AT2G38500 2-oxoglutarate (2OG) and Fe(II... Lus10025240 27.3 0.6161
AT1G11940 Core-2/I-branching beta-1,6-N-... Lus10030027 27.6 0.6108
Lus10013619 28.5 0.6671

Lus10030066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.