Lus10030072 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G55270 139 / 3e-39 Galactose oxidase/kelch repeat superfamily protein (.1)
AT1G30090 50 / 2e-07 Galactose oxidase/kelch repeat superfamily protein (.1)
AT1G67480 44 / 2e-05 Galactose oxidase/kelch repeat superfamily protein (.1.2)
AT3G61350 42 / 0.0001 SKIP4 SKP1 interacting partner 4 (.1)
AT3G59940 42 / 0.0001 Galactose oxidase/kelch repeat superfamily protein (.1)
AT3G43710 41 / 0.0003 Galactose oxidase/kelch repeat superfamily protein (.1)
AT2G44130 40 / 0.0008 Galactose oxidase/kelch repeat superfamily protein (.1)
AT3G24610 40 / 0.001 Galactose oxidase/kelch repeat superfamily protein (.1)
AT4G39756 39 / 0.001 Galactose oxidase/kelch repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001071 216 / 9e-69 AT1G55270 655 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10019425 214 / 4e-68 AT1G55270 652 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10043282 116 / 3e-34 AT1G55270 66 / 2e-14 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10042824 48 / 2e-06 AT1G30090 578 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10028121 47 / 2e-06 AT1G30090 583 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10002112 42 / 0.0002 AT1G16250 525 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10013899 40 / 0.0007 AT1G16250 523 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G217700 140 / 1e-39 AT1G55270 733 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.001G008000 140 / 1e-39 AT1G55270 731 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.006G193800 53 / 2e-08 AT1G30090 604 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.014G083200 45 / 2e-05 AT3G61350 299 / 7e-100 SKP1 interacting partner 4 (.1)
Potri.013G104300 43 / 6e-05 AT1G67480 473 / 1e-167 Galactose oxidase/kelch repeat superfamily protein (.1.2)
Potri.017G000700 42 / 0.0001 AT3G59940 283 / 2e-91 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.007G147000 41 / 0.0003 AT3G59940 300 / 4e-98 Galactose oxidase/kelch repeat superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10030072 pacid=23172604 polypeptide=Lus10030072 locus=Lus10030072.g ID=Lus10030072.BGIv1.0 annot-version=v1.0
ATGGCGGATCCTTGGAGGATGCGAGGTACTGAGAGGATGAATCAACCTCCTCTGGTTGACACAACAGCTTGCTTATGTAGAGTAGATGCAGGACTTAAAA
CAGTGGCTGGTGCGAAAAAGTACGTCCCAGGAAGTAAGCTTTGTCTTCAACCAGATATAAGACCATCCATCCACCCAACTAGACAGAAGCCGTCTCGTGG
TGATAGGAACAGGAACCAGTCCCCTTTGCTTCCTGGACTCCCTGATGATCTTGCCATTGCTTGCCTCATTCGTGTCCCGAGGGCTGAGCATCGAAAGCTT
AGGCTAGTCTGCAAAAGATGCAAGTTACATCTAGGCAATTCGTGCGCGTTGGAAGCAGCTGCGCTGGTTCCACTCAATGGAAAGTTGTGCATCATCAGAA
ACAACATGAGCATATCAGTAGTCGATGTCTCGAAATCTGAAGATCTTGTTGGGGAAGCTCTTGCTGAACATTTGTGGGAAACCCTTTCAGGGAGAGGACA
GTTCAAGACTCTGGTCTCCAACCTCTGGTCGAGCCTTGCTGGAAGGAACCGCCTGAGAAGTCACATTGTTCACTGCCAAGTTCTCCAGGCATAA
AA sequence
>Lus10030072 pacid=23172604 polypeptide=Lus10030072 locus=Lus10030072.g ID=Lus10030072.BGIv1.0 annot-version=v1.0
MADPWRMRGTERMNQPPLVDTTACLCRVDAGLKTVAGAKKYVPGSKLCLQPDIRPSIHPTRQKPSRGDRNRNQSPLLPGLPDDLAIACLIRVPRAEHRKL
RLVCKRCKLHLGNSCALEAAALVPLNGKLCIIRNNMSISVVDVSKSEDLVGEALAEHLWETLSGRGQFKTLVSNLWSSLAGRNRLRSHIVHCQVLQA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G55270 Galactose oxidase/kelch repeat... Lus10030072 0 1
AT1G05030 Major facilitator superfamily ... Lus10030010 3.3 0.9046
AT5G61830 NAD(P)-binding Rossmann-fold s... Lus10001968 9.3 0.8987
AT4G01240 S-adenosyl-L-methionine-depend... Lus10035135 14.1 0.8905
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10004346 14.9 0.8894
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10032282 15.2 0.8945
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10025068 17.9 0.8939
AT3G05390 unknown protein Lus10004494 20.6 0.8751
AT5G57770 Plant protein of unknown funct... Lus10015501 21.0 0.8729
AT3G11660 NHL1 NDR1/HIN1-like 1 (.1) Lus10004202 21.9 0.8457
AT4G19185 nodulin MtN21 /EamA-like trans... Lus10034776 26.1 0.8604

Lus10030072 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.