Lus10030078 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 74 / 2e-17 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 55 / 4e-10 EXLB2 Barwin-related endoglucanase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013118 99 / 4e-27 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10033054 99 / 9e-27 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1)
Lus10019444 93 / 1e-24 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1)
Lus10042435 79 / 3e-19 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026232 68 / 9e-15 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10019978 65 / 7e-14 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10020130 61 / 1e-11 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10031759 59 / 1e-11 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10026931 61 / 2e-11 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G252200 161 / 1e-51 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G029100 160 / 1e-51 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G155000 103 / 2e-28 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.018G031901 97 / 3e-26 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 96 / 5e-26 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.006G179300 93 / 6e-25 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G098200 89 / 4e-23 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.018G101600 88 / 6e-23 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.003G218300 74 / 1e-17 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G176300 65 / 4e-14 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10030078 pacid=23172543 polypeptide=Lus10030078 locus=Lus10030078.g ID=Lus10030078.BGIv1.0 annot-version=v1.0
ATGAGGACGGTCCACTATCACAACTCAACCTTGTTTGCAGTCGTCTGGCTGCTCATCTTATTATTATCTTCATTTCTAATAATCCCGCCCGCAGCCGCTG
ACATTGGGACTGCTACCTCCTACGACCCTCCATATTTGCCAACAAAGTGCCGTGGGAATAGGCAAGACCAGTTCCCACAAGACGGGCATTTCCTGGCGGC
TAGCGACGGCGTTTGGGACAACGGCGCAGCATGCGGGAGGAAGTACAGGGTTAGGTGCATCAGCGGCCTGAGGAGACCTTGCAAGGAGGATACTGTGGTG
GCTCAGGTGGTCGATTTCTGCCGCGTAACTCCTTGTCCCACCACCTTTGTCCTCTCCAACAAAGCTTTCGACGCCATCTCCAAACTGCCCCATTCCAAGA
TCAACATCGAATTTTCCCAGTATACATCGTTCACTCTTTCCATCGTCCACCATAACCATACATATGTACTCTAG
AA sequence
>Lus10030078 pacid=23172543 polypeptide=Lus10030078 locus=Lus10030078.g ID=Lus10030078.BGIv1.0 annot-version=v1.0
MRTVHYHNSTLFAVVWLLILLLSSFLIIPPAAADIGTATSYDPPYLPTKCRGNRQDQFPQDGHFLAASDGVWDNGAACGRKYRVRCISGLRRPCKEDTVV
AQVVDFCRVTPCPTTFVLSNKAFDAISKLPHSKINIEFSQYTSFTLSIVHHNHTYVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10030078 0 1
AT5G38200 Class I glutamine amidotransfe... Lus10035996 2.0 0.8762
AT5G59040 COPT3 copper transporter 3 (.1) Lus10021107 3.2 0.8115
AT3G16150 ASPGB1 asparaginase B1, N-terminal nu... Lus10024795 6.6 0.8500
AT4G16740 ATTPS03 terpene synthase 03 (.1.2) Lus10018500 8.2 0.8702
AT5G39150 RmlC-like cupins superfamily p... Lus10003114 8.8 0.8605
Lus10039453 8.9 0.8310
AT1G14220 Ribonuclease T2 family protein... Lus10035882 12.5 0.8042
Lus10006216 16.3 0.8129
Lus10029831 16.5 0.7911
AT2G02990 RNS1, ATRNS1 ribonuclease 1 (.1) Lus10035881 18.9 0.7910

Lus10030078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.