Lus10030083 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037707 87 / 2e-20 AT3G16780 343 / 8e-118 Ribosomal protein L19e family protein (.1)
Lus10038569 62 / 2e-12 ND /
Lus10010596 56 / 4e-10 ND /
Lus10000169 39 / 0.0006 ND /
Lus10038619 39 / 0.0006 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10030083 pacid=23172562 polypeptide=Lus10030083 locus=Lus10030083.g ID=Lus10030083.BGIv1.0 annot-version=v1.0
ATGAAGTACACTCCAAAGTCACCCTACCCAACCCCCATCAAGAAGAGATTCCTGGAGCTCATCAAAAAGCAAGAAGTCACTCGCTCTTTCTTAAAGGCCT
TCACAAAAATTCCAGCTTATGCAAAATTTCGGAAGGATGTACTAAACAAGAAGATAAACTTTAATGATACCACAAAATTCACCCTCGTTGAAGAAGGATC
AGCTATAAACATCACAATTAATGCAACTCAGGTTAAGGAAGTCAGGAAGGAGTGGAAGCGCAAATCCCAAGCATATTTTGATTTGGAAGCTAGTTTCTCT
GGAGGCAATGGAATTAAATCTCCCTTGCGAGAGGAGATTCCACCTCCATCTAGTAGTCCTCCAAAGGCTGGAGGGGGAGAAGAGGTTCTCACTAAGACTC
CTTCTGGAGTGGAGGTGATGTCCTCTTCTCAACAAGTTGAAGCCCTCGAACTTTCTACGCAAGGGGAGAGCTTTTTGTTGGGCATGTTAATGTTCACTCT
GAAGTGGTGA
AA sequence
>Lus10030083 pacid=23172562 polypeptide=Lus10030083 locus=Lus10030083.g ID=Lus10030083.BGIv1.0 annot-version=v1.0
MKYTPKSPYPTPIKKRFLELIKKQEVTRSFLKAFTKIPAYAKFRKDVLNKKINFNDTTKFTLVEEGSAINITINATQVKEVRKEWKRKSQAYFDLEASFS
GGNGIKSPLREEIPPPSSSPPKAGGGEEVLTKTPSGVEVMSSSQQVEALELSTQGESFLLGMLMFTLKW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10030083 0 1
AT4G36400 D2HGDH D-2-hydroxyglutarate dehydroge... Lus10041792 2.0 0.8644
AT1G73390 Endosomal targeting BRO1-like ... Lus10026368 2.4 0.8532
AT4G33620 Cysteine proteinases superfami... Lus10020445 4.0 0.8546
AT1G01650 ATSPPL4 ARABIDOPSIS THALIANA SIGNAL PE... Lus10017796 4.9 0.8377
AT1G55310 ATSCL33, SR33, ... SC35-like splicing factor 33 (... Lus10013539 5.5 0.8296
AT2G35510 SRO1 similar to RCD one 1 (.1) Lus10035390 7.4 0.8469
AT3G24560 RSY3 RASPBERRY 3, Adenine nucleotid... Lus10035028 9.2 0.8439
AT3G52120 SWAP (Suppressor-of-White-APri... Lus10037485 10.2 0.8500
AT4G32700 TEB TEBICHI, helicases;ATP-depende... Lus10007673 10.8 0.8322
AT2G38430 unknown protein Lus10003276 11.7 0.8147

Lus10030083 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.