Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16990 69 / 2e-15 Zinc-binding dehydrogenase family protein (.1) AT1G65560 69 / 2e-15 Zinc-binding dehydrogenase family protein (.1) AT5G16970 66 / 2e-14 AT-AER alkenal reductase (.1) AT5G38000 66 / 3e-14 Zinc-binding dehydrogenase family protein (.1) AT5G16980 65 / 3e-14 Zinc-binding dehydrogenase family protein (.1.2) AT5G17000 64 / 1e-13 Zinc-binding dehydrogenase family protein (.1) AT1G26320 61 / 1e-12 Zinc-binding dehydrogenase family protein (.1.2) AT5G37980 61 / 1e-12 Zinc-binding dehydrogenase family protein (.1) AT5G37940 59 / 4e-12 Zinc-binding dehydrogenase family protein (.1) AT5G16960 59 / 8e-12 Zinc-binding dehydrogenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001077 [exp] 120 / 4e-36 AT5G16990 182 / 1e-56 Zinc-binding dehydrogenase family protein (.1) Lus10030087 [exp] 115 / 1e-32 AT5G16990 336 / 1e-114 Zinc-binding dehydrogenase family protein (.1) Lus10010989 [exp] 66 / 4e-14 AT5G16990 483 / 2e-172 Zinc-binding dehydrogenase family protein (.1) Lus10040177 [exp] 65 / 5e-14 AT5G37980 480 / 3e-171 Zinc-binding dehydrogenase family protein (.1) Lus10007853 [exp] 65 / 6e-14 AT5G16990 468 / 3e-166 Zinc-binding dehydrogenase family protein (.1) Lus10021609 [exp] 61 / 2e-12 AT2G07340 191 / 3e-61 PREFOLDIN 1 (.1.2) Lus10040589 [exp] 60 / 3e-12 AT1G65560 446 / 3e-156 Zinc-binding dehydrogenase family protein (.1) Lus10010988 [exp] 60 / 3e-12 AT5G16990 486 / 6e-174 Zinc-binding dehydrogenase family protein (.1) Lus10007832 [exp] 60 / 4e-12 AT5G16990 464 / 3e-165 Zinc-binding dehydrogenase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G070000 [exp] 89 / 1e-22 AT5G16990 341 / 1e-116 Zinc-binding dehydrogenase family protein (.1) Potri.007G142400 [exp] 66 / 2e-14 AT5G16990 491 / 1e-175 Zinc-binding dehydrogenase family protein (.1) Potri.017G002950 [exp] 66 / 2e-14 AT5G16970 464 / 7e-165 alkenal reductase (.1) Potri.010G177700 [exp] 66 / 3e-14 AT1G65560 514 / 0.0 Zinc-binding dehydrogenase family protein (.1) Potri.017G002300 [exp] 66 / 3e-14 AT1G26320 488 / 2e-174 Zinc-binding dehydrogenase family protein (.1.2) Potri.007G143600 [exp] 65 / 5e-14 AT5G16970 501 / 1e-179 alkenal reductase (.1) Potri.017G003950 [exp] 63 / 5e-14 AT1G26320 237 / 2e-78 Zinc-binding dehydrogenase family protein (.1.2) Potri.007G143800 [exp] 64 / 1e-13 AT1G26320 490 / 4e-175 Zinc-binding dehydrogenase family protein (.1.2) Potri.017G005700 [exp] 63 / 2e-13 AT1G26320 496 / 1e-176 Zinc-binding dehydrogenase family protein (.1.2) Potri.007G143700 [exp] 62 / 4e-13 AT5G16970 495 / 2e-177 alkenal reductase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030085 pacid=23172579 polypeptide=Lus10030085 locus=Lus10030085.g ID=Lus10030085.BGIv1.0 annot-version=v1.0 ATGCTGGACGTCCTCTACAGGAGAATAACAATCCAAGGGTTTCTGGCAGCTGATTTCTGGACTCTCTTCCCTGAATTCATCTCCACAACTTGTGAACATC TCGGCTCAGGGAAGATGGTGTCTCTTGAAGACATTTCCATTGGTCTTCAAACCATTCCTTCTGCATTTGTTAGCCTCTTCACTGGTGGTAATGTTAGGAA GAAGATTGTTCAGATTTCAGAGGTCTGA
AA sequence Show only first row Show all	>Lus10030085 pacid=23172579 polypeptide=Lus10030085 locus=Lus10030085.g ID=Lus10030085.BGIv1.0 annot-version=v1.0 MLDVLYRRITIQGFLAADFWTLFPEFISTTCEHLGSGKMVSLEDISIGLQTIPSAFVSLFTGGNVRKKIVQISEV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030085 [exp]	0	1
AT5G16920			Fasciclin-like arabinogalactan...		Lus10013786 [exp]	1.7	0.8961
					Lus10014515 [exp]	2.4	0.9057
					Lus10037007 [exp]	3.5	0.8344
					Lus10004778 [exp]	3.9	0.9155
AT4G38190		ATCSLD4	ARABIDOPSIS THALIANA CELLULOSE...		Lus10022982 [exp]	8.1	0.7937
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10037934 [exp]	8.7	0.8633
AT5G24090		ATCHIA	chitinase A (.1)		Lus10040420 [exp]	8.8	0.8536
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030086 [exp]	8.8	0.7646
AT1G14190			Glucose-methanol-choline (GMC)...		Lus10009914 [exp]	9.5	0.8273
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Lus10016115 [exp]	9.8	0.8036

Compare expression of checked genes

Lus10030085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.