Lus10030101 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25360 79 / 2e-20 unknown protein
AT1G15350 69 / 5e-17 unknown protein
AT3G15770 63 / 2e-14 unknown protein
AT4G32342 62 / 4e-14 unknown protein
AT3G54880 58 / 9e-13 unknown protein
AT5G03440 56 / 3e-12 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002164 86 / 3e-23 AT5G25360 174 / 3e-56 unknown protein
Lus10005466 80 / 9e-22 AT5G25360 99 / 6e-28 unknown protein
Lus10013824 60 / 2e-13 AT3G54880 108 / 1e-31 unknown protein
Lus10026537 55 / 6e-12 AT5G03440 97 / 5e-28 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G027800 79 / 4e-20 AT5G25360 182 / 1e-58 unknown protein
Potri.006G068600 77 / 7e-20 AT5G25360 194 / 9e-64 unknown protein
Potri.006G254000 76 / 2e-19 AT5G25360 197 / 3e-65 unknown protein
Potri.001G192700 73 / 4e-18 AT5G25360 169 / 1e-54 unknown protein
Potri.018G130900 69 / 1e-16 AT5G25360 140 / 8e-43 unknown protein
Potri.008G034600 64 / 5e-15 AT3G54880 120 / 8e-37 unknown protein
Potri.010G227800 61 / 4e-14 AT3G54880 123 / 7e-38 unknown protein
PFAM info
Representative CDS sequence
>Lus10030101 pacid=23172591 polypeptide=Lus10030101 locus=Lus10030101.g ID=Lus10030101.BGIv1.0 annot-version=v1.0
ATGGTGACACGAGCTAACAACTCTATCTGTTCTTGGATCCGTCACTTTCTGGCTTGTATAAGTTGGAATGCAAGTTATGAAAGTTTGCTTGGGAGCAGAA
ACCGTTTTACTCGGCCTGTCCCGCTCTCTGAAATGGTAGATTTTCTAGTGGATGTATGGGAGCAGGAAGGGTTGTATGATTGA
AA sequence
>Lus10030101 pacid=23172591 polypeptide=Lus10030101 locus=Lus10030101.g ID=Lus10030101.BGIv1.0 annot-version=v1.0
MVTRANNSICSWIRHFLACISWNASYESLLGSRNRFTRPVPLSEMVDFLVDVWEQEGLYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25360 unknown protein Lus10030101 0 1
AT1G68910 WIT2 WPP domain-interacting protein... Lus10013053 6.0 0.8288
AT4G18910 ATNLM2, NIP1;2,... NOD26-LIKE INTRINSIC PROTEIN 2... Lus10007322 11.5 0.7851
Lus10006286 13.7 0.8105
AT1G04280 P-loop containing nucleoside t... Lus10021226 14.2 0.8275
AT1G03590 Protein phosphatase 2C family ... Lus10031631 18.2 0.8082
AT3G22190 IQD5 IQ-domain 5 (.1.2) Lus10013362 22.2 0.8048
AT4G14305 Peroxisomal membrane 22 kDa (M... Lus10011798 24.2 0.8277
AT1G69870 NRT1.7 nitrate transporter 1.7 (.1) Lus10037221 34.2 0.8143
AT5G08160 ATPK3 serine/threonine protein kinas... Lus10007963 39.1 0.7678
AT5G49950 alpha/beta-Hydrolases superfam... Lus10037325 39.6 0.7860

Lus10030101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.