Lus10030112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80530 223 / 2e-69 Major facilitator superfamily protein (.1)
AT4G34950 167 / 3e-48 Major facilitator superfamily protein (.1)
AT2G16660 149 / 4e-42 Major facilitator superfamily protein (.1)
AT5G14120 143 / 1e-39 Major facilitator superfamily protein (.1)
AT3G01930 136 / 1e-37 Major facilitator superfamily protein (.1.2)
AT5G50520 130 / 4e-35 Major facilitator superfamily protein (.1)
AT5G50630 130 / 4e-35 Major facilitator superfamily protein (.1)
AT1G18940 116 / 4e-30 Nodulin-like / Major Facilitator Superfamily protein (.1)
AT2G39210 117 / 6e-30 Major facilitator superfamily protein (.1)
AT1G74780 115 / 9e-30 Nodulin-like / Major Facilitator Superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001678 317 / 6e-106 AT1G80530 649 / 0.0 Major facilitator superfamily protein (.1)
Lus10017971 249 / 9e-80 AT1G80530 716 / 0.0 Major facilitator superfamily protein (.1)
Lus10041962 249 / 1e-79 AT1G80530 715 / 0.0 Major facilitator superfamily protein (.1)
Lus10028803 239 / 7e-76 AT1G80530 707 / 0.0 Major facilitator superfamily protein (.1)
Lus10017480 238 / 3e-75 AT1G80530 702 / 0.0 Major facilitator superfamily protein (.1)
Lus10034491 154 / 2e-43 AT4G34950 788 / 0.0 Major facilitator superfamily protein (.1)
Lus10025053 153 / 3e-43 AT4G34950 793 / 0.0 Major facilitator superfamily protein (.1)
Lus10023961 133 / 7e-36 AT5G14120 598 / 0.0 Major facilitator superfamily protein (.1)
Lus10032034 133 / 8e-36 AT3G01930 874 / 0.0 Major facilitator superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G060900 301 / 1e-99 AT1G80530 632 / 0.0 Major facilitator superfamily protein (.1)
Potri.003G012300 241 / 1e-76 AT1G80530 650 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G204700 231 / 7e-73 AT1G80530 625 / 0.0 Major facilitator superfamily protein (.1)
Potri.004G173400 159 / 1e-45 AT4G34950 682 / 0.0 Major facilitator superfamily protein (.1)
Potri.009G132700 152 / 5e-43 AT4G34950 661 / 0.0 Major facilitator superfamily protein (.1)
Potri.005G112400 138 / 9e-38 AT4G34950 618 / 0.0 Major facilitator superfamily protein (.1)
Potri.012G098900 136 / 6e-37 AT5G14120 681 / 0.0 Major facilitator superfamily protein (.1)
Potri.017G064201 135 / 2e-36 AT3G01930 805 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.001G329100 135 / 2e-36 AT3G01930 869 / 0.0 Major facilitator superfamily protein (.1.2)
Potri.003G016725 114 / 6e-32 AT1G80530 160 / 2e-47 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10030112 pacid=23172586 polypeptide=Lus10030112 locus=Lus10030112.g ID=Lus10030112.BGIv1.0 annot-version=v1.0
ATGGGAGCTTTAAGGAATCTGATTACCGGTCTGAGTTGGCTTTGCTTCTTGCTTCTTGCTGAAGGGGAAGGGGCGGTAGTGAAGAATAAGAAGAGGAAGC
CTAGAAGAGGTCAGGATTTCAGCTTTAGTGAGGCTGTAGTGAAGGCTGACTTCTGGCGTATTTTCTCTGTTTACTTTGTCGGAGTTGGATCCGGTTTGAC
TGTGCTCAACAATCTCGGTCAGATTGGGATTGCTCAAGGGATGCATGACACCACCATCTTGTTGTCACTCTTTAGCTTCTGCAACTTTGCTGGCCGTCTT
GGTGGTGGAGCTGTCTCTGAGCATTCGTCAGCATTAGACGGGACCCTTTACGTTGCAACTGCATTGCTGGGAGTCTGCTACAGGGTTCAGTTCTCTGTCA
TGATCCCAACTGTCTCCGAGCTCTTCGGGCTGAAACACTTTGGCATCTTTTACAACTTCATATCGCTTGGAAACCCCATTGGTGCGTTCCTTTTCTCAGG
TCTTCTAGCTGCACATGTTTACGACACGGAGGCAGCCAAGCAGCATGGACCGAATTCACTCTACAGTTCATCATCAGGGTTCTCCTGCTTAGGTCCAGAT
TGCTTCAGGCTCGCCTTCTTGGTTCTGGCTGCTGCTTCTGGAATCGGCTCAATCGTGCGTTTCGTCAACTTTAAGGATCAAGCCAGTCTATGA
AA sequence
>Lus10030112 pacid=23172586 polypeptide=Lus10030112 locus=Lus10030112.g ID=Lus10030112.BGIv1.0 annot-version=v1.0
MGALRNLITGLSWLCFLLLAEGEGAVVKNKKRKPRRGQDFSFSEAVVKADFWRIFSVYFVGVGSGLTVLNNLGQIGIAQGMHDTTILLSLFSFCNFAGRL
GGGAVSEHSSALDGTLYVATALLGVCYRVQFSVMIPTVSELFGLKHFGIFYNFISLGNPIGAFLFSGLLAAHVYDTEAAKQHGPNSLYSSSSGFSCLGPD
CFRLAFLVLAAASGIGSIVRFVNFKDQASL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80530 Major facilitator superfamily ... Lus10030112 0 1
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Lus10002667 8.4 0.6064
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10016891 41.1 0.5735
Lus10024617 60.3 0.5410
AT5G45120 Eukaryotic aspartyl protease f... Lus10040623 83.8 0.5146
AT1G22590 MADS AGL87 AGAMOUS-like 87 (.1.2) Lus10023293 84.9 0.5167
AT4G19810 ChiC class V chitinase, Glycosyl hy... Lus10000981 103.5 0.5151
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Lus10003551 151.6 0.4907
Lus10031954 173.6 0.4569
AT1G60410 F-box family protein (.1) Lus10020292 234.0 0.4664
AT3G06240 F-box family protein (.1) Lus10011015 241.5 0.4627

Lus10030112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.