Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05150 88 / 5e-22 Calcium-binding tetratricopeptide family protein (.1) AT2G32450 81 / 8e-20 Calcium-binding tetratricopeptide family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033182 [exp] 90 / 1e-22 AT2G32450 1323 / 0.0 Calcium-binding tetratricopeptide family protein (.1) Lus10038571 [exp] 46 / 2e-08 AT2G32450 62 / 2e-13 Calcium-binding tetratricopeptide family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G234900 [exp] 85 / 6e-21 AT1G05150 1239 / 0.0 Calcium-binding tetratricopeptide family protein (.1) Potri.002G027900 [exp] 82 / 3e-20 AT1G05150 1226 / 0.0 Calcium-binding tetratricopeptide family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030122 pacid=23172607 polypeptide=Lus10030122 locus=Lus10030122.g ID=Lus10030122.BGIv1.0 annot-version=v1.0 ATGGCCACTAGAGGGAGAAAATCCGAGAATTTCAAGAGGATTTTCCAGCAATTCGACGTGAAACGTGAATACGGCCTCAACATGGGCGAAATGACCACTC TTGTCGTCGCCGTTAACCCTAAGGTCAAATTCAGCGACGAACAAATTTACACTAATCTCGACGAAGTCTTCCATACCTGCGTCGAGTTCATGGACACCAA CAATATTAAATTTCGTGATAGATAG
AA sequence Show only first row Show all	>Lus10030122 pacid=23172607 polypeptide=Lus10030122 locus=Lus10030122.g ID=Lus10030122.BGIv1.0 annot-version=v1.0 MATRGRKSENFKRIFQQFDVKREYGLNMGEMTTLVVAVNPKVKFSDEQIYTNLDEVFHTCVEFMDTNNIKFRDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05150			Calcium-binding tetratricopept...		Lus10030122 [exp]	0	1

Compare expression of checked genes

Lus10030122 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.