Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32680 38 / 6e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007686 [exp] 96 / 3e-26 AT1G52343 102 / 2e-25 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030126 pacid=23172576 polypeptide=Lus10030126 locus=Lus10030126.g ID=Lus10030126.BGIv1.0 annot-version=v1.0 ATGGTGGAAATGCCGTCACCGAGTGGCAGTTATGAATGGGCTGCACAAGCAAGTAAGGCGCTTGAGATAAGTTTAATGGCCAAGAAAGCAGTTGATGCGA TACTGATGGATGCCAGTGTTTATGCGATCATTGTTGTTTGTGCTTTCTGCCTTCTAGGGCTTTGA
AA sequence Show only first row Show all	>Lus10030126 pacid=23172576 polypeptide=Lus10030126 locus=Lus10030126.g ID=Lus10030126.BGIv1.0 annot-version=v1.0 MVEMPSPSGSYEWAAQASKALEISLMAKKAVDAILMDASVYAIIVVCAFCLLGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030126 [exp]	0	1
AT1G24625	C2H2ZnF	ZFP7	zinc finger protein 7 (.1)		Lus10003681 [exp]	4.0	0.7861
AT5G51410			LUC7 N_terminus domain-contain...		Lus10027212 [exp]	9.4	0.7512
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	13.0	0.7553
AT3G18440		ATALMT9	aluminum-activated malate tran...		Lus10041471 [exp]	16.6	0.7376
AT5G64350		FKP12, ATFKBP12...	ARABIDOPSIS THALIANA FK506-BIN...		Lus10016586 [exp]	16.8	0.7498
AT1G05070			Protein of unknown function (D...		Lus10020038 [exp]	17.7	0.7506
AT3G47860		CHL	chloroplastic lipocalin (.1)		Lus10037318 [exp]	22.0	0.7588
AT1G13570			F-box/RNI-like superfamily pro...		Lus10004851 [exp]	26.0	0.7360
					Lus10032581 [exp]	29.1	0.7391
					Lus10022623 [exp]	29.4	0.7066

Compare expression of checked genes

Lus10030126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.