Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58400 66 / 2e-14 Peroxidase superfamily protein (.1) AT5G05340 65 / 6e-14 Peroxidase superfamily protein (.1) AT5G58390 62 / 7e-13 Peroxidase superfamily protein (.1) AT1G71695 59 / 6e-12 Peroxidase superfamily protein (.1) AT4G36430 57 / 2e-11 Peroxidase superfamily protein (.1) AT1G68850 55 / 2e-10 Peroxidase superfamily protein (.1) AT2G18140 54 / 3e-10 Peroxidase superfamily protein (.1) AT1G14550 54 / 3e-10 Peroxidase superfamily protein (.1) AT2G18150 54 / 5e-10 Peroxidase superfamily protein (.1) AT3G50990 52 / 1e-09 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009935 [exp] 128 / 7e-38 AT5G05340 358 / 9e-124 Peroxidase superfamily protein (.1) Lus10008581 [exp] 79 / 3e-19 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1) Lus10030145 [exp] 74 / 3e-17 AT5G05340 353 / 2e-121 Peroxidase superfamily protein (.1) Lus10009936 [exp] 71 / 4e-16 AT5G05340 361 / 5e-125 Peroxidase superfamily protein (.1) Lus10009932 [exp] 69 / 3e-15 AT5G05340 419 / 6e-146 Peroxidase superfamily protein (.1) Lus10006534 [exp] 68 / 6e-15 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1) Lus10025255 [exp] 65 / 5e-14 AT5G05340 337 / 2e-115 Peroxidase superfamily protein (.1) Lus10000346 [exp] 65 / 6e-14 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1) Lus10009933 [exp] 62 / 9e-13 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G156800 [exp] 82 / 2e-20 AT5G05340 345 / 7e-119 Peroxidase superfamily protein (.1) Potri.010G134500 [exp] 66 / 4e-14 AT1G68850 459 / 2e-163 Peroxidase superfamily protein (.1) Potri.001G458900 [exp] 63 / 2e-13 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1) Potri.001G458700 [exp] 63 / 3e-13 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1) Potri.016G132900 [exp] 62 / 6e-13 AT5G05340 350 / 6e-121 Peroxidase superfamily protein (.1) Potri.013G156500 [exp] 61 / 2e-12 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1) Potri.013G083600 [exp] 60 / 2e-12 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1) Potri.016G132800 [exp] 59 / 5e-12 AT5G05340 336 / 3e-115 Peroxidase superfamily protein (.1) Potri.002G031200 [exp] 56 / 6e-11 AT1G44970 492 / 6e-176 Peroxidase superfamily protein (.1) Potri.006G107000 [exp] 56 / 7e-11 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [flax] [poplar] Peroxidase PF00141 [flax] [poplar] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Lus10030146 pacid=23172578 polypeptide=Lus10030146 locus=Lus10030146.g ID=Lus10030146.BGIv1.0 annot-version=v1.0 ATGTCCAACTTCCAATCCCACGGCCTCAACATCACCAACCTCGTGGCGCTTTCGAGAGGACACACCATCGGCGTCTCTCGTTGGGTCGATTTCCAAAACC GGATCTACAACAACACCTCCAACAGCATTCGACCCCAATTCGCTTCCTCTTTGCAACATAATTGCCCGACGGCCACCGGAAGCGGGGACAACAACACCCA GGCTCTCGAGCAGACTTTCGGGGGATTTGACATCTAG
AA sequence Show only first row Show all	>Lus10030146 pacid=23172578 polypeptide=Lus10030146 locus=Lus10030146.g ID=Lus10030146.BGIv1.0 annot-version=v1.0 MSNFQSHGLNITNLVALSRGHTIGVSRWVDFQNRIYNNTSNSIRPQFASSLQHNCPTATGSGDNNTQALEQTFGGFDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58400			Peroxidase superfamily protein...		Lus10030146 [exp]	0	1
AT5G66630		DAR5	DA1-related protein 5 (.1)		Lus10009329 [exp]	3.6	0.7012
AT3G03000			EF hand calcium-binding protei...		Lus10004610 [exp]	7.5	0.6749
AT1G07420		SMO2-1, ATSMO1,...	Arabidopsis thaliana sterol 4-...		Lus10004988 [exp]	12.5	0.6615
AT3G55150		ATEXO70H1	exocyst subunit exo70 family p...		Lus10040331 [exp]	13.0	0.6126
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10025506 [exp]	15.4	0.6806
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	24.1	0.6013
					Lus10033096 [exp]	25.2	0.6013
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	26.2	0.6013
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Lus10015748 [exp]	26.5	0.5720
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	27.2	0.6013

Compare expression of checked genes

Lus10030146 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.