Lus10030147 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30330 163 / 9e-53 BLOS1 BLOC subunit 1, GCN5L1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G156700 176 / 1e-57 AT2G30330 154 / 5e-49 BLOC subunit 1, GCN5L1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06320 GCN5L1 GCN5-like protein 1 (GCN5L1)
Representative CDS sequence
>Lus10030147 pacid=23172605 polypeptide=Lus10030147 locus=Lus10030147.g ID=Lus10030147.BGIv1.0 annot-version=v1.0
ATGGAGAGATCCCAGGCTGAGGTCGGAGCTCTTGAAGCGTCGCTTATTCACCTTGTCCAGGATCACCAACAAGCTGCTCTCCACCTGCGAGAGCAAACAG
AGAAAGCTAAGAAAGATGCGATTAGGAAAGCGGTGAGAGTGTCAAATCTGTTAGTAGATGCTGTAAATGGCGGTGTAGAAGAGTCGTTTATAATTGAGAA
GCAGATTGAATCAGAGATACGAGCATTGGCAGCCACTATTACCCGGTTCATGAAGCAGAGTGATCAATGGTTATCTGCCACTCACGCTATGAACACTGCA
ATCAAGGAAATTGGAGACTTTGAGAACTGGATGAAGGTGATGGAGTTCGATTGCAAAAGCATTGGCGCAGCTATCCATAACATTCACAAAGAGTGA
AA sequence
>Lus10030147 pacid=23172605 polypeptide=Lus10030147 locus=Lus10030147.g ID=Lus10030147.BGIv1.0 annot-version=v1.0
MERSQAEVGALEASLIHLVQDHQQAALHLREQTEKAKKDAIRKAVRVSNLLVDAVNGGVEESFIIEKQIESEIRALAATITRFMKQSDQWLSATHAMNTA
IKEIGDFENWMKVMEFDCKSIGAAIHNIHKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30330 BLOS1 BLOC subunit 1, GCN5L1 family ... Lus10030147 0 1
AT3G19630 Radical SAM superfamily protei... Lus10020989 1.4 0.8463
AT5G06240 EMB2735 embryo defective 2735 (.1) Lus10021327 2.0 0.8210
AT5G09900 RPN5A, MSA, EMB... REGULATORY PARTICLE NON-ATPASE... Lus10006797 3.7 0.8135
AT5G43280 ATDCI1 "delta\(3,5\),delta\(2,4\)-die... Lus10002583 6.8 0.8322
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10012399 8.5 0.7908
AT1G62280 SLAH1 SLAC1 homologue 1 (.1) Lus10031545 8.8 0.7897
AT2G27830 unknown protein Lus10000385 8.9 0.7961
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10016317 12.0 0.8022
AT1G12855 F-box family protein (.1) Lus10029699 12.6 0.8080
AT4G11600 LSC803, PHGPX, ... glutathione peroxidase 6 (.1) Lus10000603 12.8 0.8024

Lus10030147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.