Lus10030148 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
AT5G58400 393 / 3e-138 Peroxidase superfamily protein (.1)
AT5G58390 367 / 2e-128 Peroxidase superfamily protein (.1)
AT1G14550 341 / 8e-118 Peroxidase superfamily protein (.1)
AT1G14540 319 / 3e-109 Peroxidase superfamily protein (.1)
AT2G18150 298 / 7e-101 Peroxidase superfamily protein (.1)
AT4G36430 296 / 6e-100 Peroxidase superfamily protein (.1)
AT5G06720 292 / 1e-98 ATPA2 peroxidase 2 (.1)
AT2G18140 288 / 8e-97 Peroxidase superfamily protein (.1)
AT5G06730 287 / 3e-96 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009933 501 / 0 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1)
Lus10009934 486 / 8e-176 AT5G05340 372 / 5e-130 Peroxidase superfamily protein (.1)
Lus10030149 447 / 3e-159 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1)
Lus10009932 439 / 8e-155 AT5G05340 419 / 6e-146 Peroxidase superfamily protein (.1)
Lus10034207 395 / 3e-139 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10024209 360 / 4e-125 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Lus10006534 347 / 3e-120 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10000346 346 / 8e-119 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10032786 339 / 3e-117 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G156500 449 / 2e-160 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.013G083600 398 / 2e-140 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.013G156400 396 / 6e-139 AT5G05340 412 / 1e-144 Peroxidase superfamily protein (.1)
Potri.010G236890 370 / 2e-129 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1)
Potri.010G236870 369 / 8e-129 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.013G154400 368 / 2e-128 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.010G236900 366 / 5e-128 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.001G458700 363 / 2e-126 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
Potri.008G022700 362 / 4e-126 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1)
Potri.008G022232 360 / 1e-125 AT1G14550 401 / 6e-141 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10030148 pacid=23172612 polypeptide=Lus10030148 locus=Lus10030148.g ID=Lus10030148.BGIv1.0 annot-version=v1.0
ATGAAGACAGTGAGATCCGCCGTGCAATCCGCCGTCTCCAAGGAAACAAGGGTGGCTGCCTCTCTTATCCGCTTGCATTTCCACGATTGTTTCGTCAACG
GTTGTGATGGATCGATATTACTGGAAGACACAGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAATGCCGGATCAGTGAGAGGATTTAACGTAATCAA
AGACATAAAGTCCAAGGTTGAGAAAGTCTGCCCAGGCGTCGTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATTGCAGGGGGC
AAAAGTTGGAAGGTGAGGCTTGGAAGGAGGGATTCCAAAACAGCTAGTTTGGCTGCAGCAAACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACC
AACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGGTCGTTCTCTCCGGATCCCACACGATTGGACAAGCTAGGTGCGTAACATTCAG
GAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTTGCAAGAGGCCGACAGCAGAAGTGCCCCAGGGCTCAAAACTCAGGGAACAACAATTTGGCC
CCATTTGACGTTACGACTCCCAAGTTGTTAGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCTGACCAAGTCTTGTTCAACG
GTGGATCGACTGATTCCCTTGTACGATCCTACAGTCGTAATCCAAAGGCCTTCGCCGCGGACTTTGCATCTGCGATGATCAAGATGGGAAGCATAAGTCC
CCTCACTGGTTCTCAAGGCGAGATCAGGAAGATATGTAGCAGGCCTAACTAA
AA sequence
>Lus10030148 pacid=23172612 polypeptide=Lus10030148 locus=Lus10030148.g ID=Lus10030148.BGIv1.0 annot-version=v1.0
MKTVRSAVQSAVSKETRVAASLIRLHFHDCFVNGCDGSILLEDTASFTGEQTALPNAGSVRGFNVIKDIKSKVEKVCPGVVSCADILAIAARDSTAIAGG
KSWKVRLGRRDSKTASLAAANSGVIPPPTATLNQLITRFQARGLSAKDMVVLSGSHTIGQARCVTFRNRIYNETNIDSSFARGRQQKCPRAQNSGNNNLA
PFDVTTPKLLDNKYYQNLIQQKGLLHSDQVLFNGGSTDSLVRSYSRNPKAFAADFASAMIKMGSISPLTGSQGEIRKICSRPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05340 Peroxidase superfamily protein... Lus10030148 0 1
AT3G62040 Haloacid dehalogenase-like hyd... Lus10038016 1.7 0.7786
AT3G49210 O-acyltransferase (WSD1-like) ... Lus10017721 8.8 0.7124
AT2G31800 Integrin-linked protein kinase... Lus10007432 9.6 0.7753
AT5G60590 DHBP synthase RibB-like alpha/... Lus10041302 10.5 0.7179
AT3G57240 BG3 "beta-1,3-glucanase 3", beta-1... Lus10002807 10.8 0.6953
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Lus10010821 15.9 0.6876
AT5G18260 RING/U-box superfamily protein... Lus10035820 16.0 0.6365
AT3G62040 Haloacid dehalogenase-like hyd... Lus10009256 18.4 0.6928
Lus10039654 28.6 0.6873
AT4G32790 Exostosin family protein (.1) Lus10000608 29.6 0.7081

Lus10030148 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.