Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031803 [exp] 94 / 3e-24 AT5G06310 226 / 5e-69 protection of telomeres 1b, Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G046400 [exp] 39 / 9e-05 AT5G06310 330 / 2e-108 protection of telomeres 1b, Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030151 pacid=23172582 polypeptide=Lus10030151 locus=Lus10030151.g ID=Lus10030151.BGIv1.0 annot-version=v1.0 ATGGAAGCAACAAGTCCAGCTCATTTTAATTCGATTCCTTCATCCAAGAAGAGGAAATTCTTTTATGAACATCCATCACCAGAGCCAGTGCCATGGAAGC TAGATGGACTCCTTGACATAACCACAAACAAAGACGATGCGAGAAATGAACCGCCACATAATGCACCCTGGATAGGCGTGTGTCTCGAATGGCACTACCA TGACGAAACGAAAGAGTATAGGATATGCGACCCCAAGAAGCTTTTGTAA
AA sequence Show only first row Show all	>Lus10030151 pacid=23172582 polypeptide=Lus10030151 locus=Lus10030151.g ID=Lus10030151.BGIv1.0 annot-version=v1.0 MEATSPAHFNSIPSSKKRKFFYEHPSPEPVPWKLDGLLDITTNKDDARNEPPHNAPWIGVCLEWHYHDETKEYRICDPKKLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030151 [exp]	0	1
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10032217 [exp]	1.4	0.9152
AT1G53440			Leucine-rich repeat transmembr...		Lus10038153 [exp]	2.8	0.9021
AT2G16050			Cysteine/Histidine-rich C1 dom...		Lus10017477 [exp]	3.3	0.8707
AT3G13690			Protein kinase protein with ad...		Lus10030950 [exp]	3.6	0.8675
					Lus10016958 [exp]	3.7	0.9105
AT1G07010		AtSLP1	Shewenella-like protein phosph...		Lus10031854 [exp]	4.5	0.8730
AT4G10160			RING/U-box superfamily protein...		Lus10016924 [exp]	5.5	0.8920
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10012693 [exp]	5.7	0.8885
AT1G06130		GLX2-4	glyoxalase 2-4 (.1.2)		Lus10039860 [exp]	7.7	0.8668
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10027846 [exp]	8.3	0.9024

Compare expression of checked genes

Lus10030151 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.