Lus10030164 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
AT3G61980 49 / 4e-09 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010286 94 / 3e-27 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010285 60 / 2e-13 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1)
Lus10030166 55 / 5e-11 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010287 54 / 8e-11 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1)
Lus10007864 54 / 2e-10 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1)
Lus10009866 51 / 5e-10 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1)
Lus10009865 48 / 1e-08 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010094 47 / 1e-08 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G108700 57 / 2e-12 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1)
Potri.002G182800 56 / 1e-11 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108600 55 / 3e-11 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1)
Potri.015G001800 53 / 2e-10 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G109000 47 / 1e-08 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108900 46 / 3e-08 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108800 45 / 6e-08 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence
>Lus10030164 pacid=23152985 polypeptide=Lus10030164 locus=Lus10030164.g ID=Lus10030164.BGIv1.0 annot-version=v1.0
ATGGCCGCGGCGATGTCGATGAAGAAACTGTGGGTGGTGATGATGTTGGTGGCGGTGCTGGTGGCGTCGGCGTCGGCGCAAACTGATCCGTGTGAATTTG
AGTCTCCGCCGTTCGTCTGCCCATTCACCTGTACCCGACCCAACCCAGTCTGCGGGGCTAACGGCGTCACCTACAACTGCGGCTGCTCTGACGCCGCTTG
CGCATCCGTCCGAGTCGTCAGGATCGGGCCTTGTTAG
AA sequence
>Lus10030164 pacid=23152985 polypeptide=Lus10030164 locus=Lus10030164.g ID=Lus10030164.BGIv1.0 annot-version=v1.0
MAAAMSMKKLWVVMMLVAVLVASASAQTDPCEFESPPFVCPFTCTRPNPVCGANGVTYNCGCSDAACASVRVVRIGPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G01575 serine protease inhibitor, Kaz... Lus10030164 0 1
AT1G73260 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TR... Lus10004223 2.6 0.9811
AT4G19810 ChiC class V chitinase, Glycosyl hy... Lus10036310 7.4 0.9615
AT4G19810 ChiC class V chitinase, Glycosyl hy... Lus10019060 8.0 0.9782
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10005262 10.4 0.9684
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10038526 11.2 0.9635
Lus10000859 13.6 0.9699
AT4G04450 WRKY ATWRKY42, WRKY4... WRKY family transcription fact... Lus10015546 22.9 0.9677
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10000193 23.4 0.9618
AT5G02260 ATHEXPALPHA1.10... expansin A9 (.1) Lus10023902 24.1 0.9304
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10023280 26.5 0.9625

Lus10030164 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.