Lus10030165 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62840 148 / 3e-44 Phosphoglycerate mutase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007865 177 / 2e-56 AT5G62840 390 / 2e-138 Phosphoglycerate mutase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G074700 154 / 2e-46 AT5G62840 407 / 3e-144 Phosphoglycerate mutase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10030165 pacid=23153206 polypeptide=Lus10030165 locus=Lus10030165.g ID=Lus10030165.BGIv1.0 annot-version=v1.0
ATGCTAACGGCCACAAGTACTCCACCGCCACCGTCGATGTCTCCCTCATCCGCCGCTACCGCAAAACCGCCGCTGATTTCTCTCAAGAAGCCAATTAACC
GCCGCCACCTCCTCTTTGCGGCAATTTCTCTCTCAGCCGCCCTTCCTCTACACAAACAACAACCGGCCGAAGCAGCCTCTTGCAAATGCCGCCGTTCCGC
CTCATCAATCGGTAAAGTTTCTCTTGTAAAGATGCAGACTGTGAAATCGGCTCTGAAGTTGAAATCCATCGGAGCTTGTGACAATGGGTTCTTGATTTGG
ACTTCTATTACCCAGAGAGCTTATCAGGCCGCTGAAGTTATTGCTGCTGTTAATGGCATCACTAGGAGTTACATAGTTCCTGAGGAGTACAGCTTCTTGG
ATGCTCGTGGGTTGGGAGGATACGAAGGCAAGAGCCTAGAGGCTGTCTCAGAAGTGTATGCATCGGAAGCCATTTCTCAAAGAAGCAAACCACCACCAAT
CGACGATGGGACACCACAAGCGAGAGCATCCAGGACGTGTTTGTTCGTGTGA
AA sequence
>Lus10030165 pacid=23153206 polypeptide=Lus10030165 locus=Lus10030165.g ID=Lus10030165.BGIv1.0 annot-version=v1.0
MLTATSTPPPPSMSPSSAATAKPPLISLKKPINRRHLLFAAISLSAALPLHKQQPAEAASCKCRRSASSIGKVSLVKMQTVKSALKLKSIGACDNGFLIW
TSITQRAYQAAEVIAAVNGITRSYIVPEEYSFLDARGLGGYEGKSLEAVSEVYASEAISQRSKPPPIDDGTPQARASRTCLFV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62840 Phosphoglycerate mutase family... Lus10030165 0 1
AT2G40170 GEA6, ATEM6 LATE EMBRYOGENESIS ABUNDANT 6,... Lus10030394 1.0 0.9021
AT5G01750 Protein of unknown function (D... Lus10014154 3.5 0.7563
AT2G14540 ATSRP2 serpin 2 (.1) Lus10009905 3.5 0.7756
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10031234 5.3 0.8063
AT5G13920 GRF zinc finger / Zinc knuckle... Lus10020975 6.3 0.6776
AT5G06839 bZIP TGA10, bZIP65 TGACG \(TGA\) motif-binding pr... Lus10035499 6.3 0.7620
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10012001 6.7 0.7602
AT3G03470 CYP89A9 "cytochrome P450, family 87, s... Lus10020361 13.4 0.7463
AT3G22490 Seed maturation protein (.1) Lus10015948 13.7 0.7307
AT1G72940 Toll-Interleukin-Resistance (T... Lus10041605 13.8 0.7448

Lus10030165 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.