Lus10030166 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01575 91 / 4e-24 serine protease inhibitor, Kazal-type family protein (.1)
AT3G61980 88 / 3e-23 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007864 179 / 4e-59 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010285 67 / 3e-15 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010287 65 / 2e-14 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010094 62 / 2e-13 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1)
Lus10009866 61 / 4e-13 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1)
Lus10010286 57 / 2e-11 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1)
Lus10030164 55 / 7e-11 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1)
Lus10009865 49 / 2e-08 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G108600 112 / 1e-32 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1)
Potri.002G182800 96 / 2e-26 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1)
Potri.015G001800 82 / 2e-20 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G109000 68 / 8e-16 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108900 67 / 2e-15 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108700 66 / 3e-15 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1)
Potri.014G108800 52 / 7e-10 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence
>Lus10030166 pacid=23152958 polypeptide=Lus10030166 locus=Lus10030166.g ID=Lus10030166.BGIv1.0 annot-version=v1.0
ATGAGGCGAGCCACGAGGTCGTGGATCGCGGTTCCGGCGTCGTTATTTCTGCTGTTGCTGTTGTGTGTTTGCTCATCTCCGTCCACGGTGGTGGCGCAAT
CGGAAGAGAAGGTGATTCATCAAGTTACGGAGAAAGAATCCGGCGACGTATGCGGTGGTTCGTCTGTTCCTCCGGCGGCGTCCTCGTGCCCGATCAACTG
TTTCCGTGCCGATCCGGTCTGCGGCGCCGACGGCGTCACATACTGGTGCGGATGCGCTGACGCTGCCTGCCACGGGACTAAGGTGGCGAAGCTAGGAGCC
TGCGAGGTCGGAAGCGGAGGCAGCAGCGCTTCCCTCCCTGGTCAGGCGCTCCTCCTTGTTCACATCGTTTGGCTCTTCTTGCTCGGCTTCTCTTTGCTGT
TCGGCCTCTTCTGA
AA sequence
>Lus10030166 pacid=23152958 polypeptide=Lus10030166 locus=Lus10030166.g ID=Lus10030166.BGIv1.0 annot-version=v1.0
MRRATRSWIAVPASLFLLLLLCVCSSPSTVVAQSEEKVIHQVTEKESGDVCGGSSVPPAASSCPINCFRADPVCGADGVTYWCGCADAACHGTKVAKLGA
CEVGSGGSSASLPGQALLLVHIVWLFLLGFSLLFGLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G01575 serine protease inhibitor, Kaz... Lus10030166 0 1
AT4G09830 Uncharacterised conserved prot... Lus10028732 2.0 0.8259
AT3G11660 NHL1 NDR1/HIN1-like 1 (.1) Lus10016960 2.6 0.8528
AT4G15470 Bax inhibitor-1 family protein... Lus10041240 3.0 0.8255
AT3G16510 Calcium-dependent lipid-bindin... Lus10006523 6.3 0.8082
AT2G21100 Disease resistance-responsive ... Lus10034482 6.3 0.8061
AT5G27280 Zim17-type zinc finger protein... Lus10021838 8.4 0.7652
AT5G02270 ABCI20, ATNAP9 ARABIDOPSIS THALIANA NON-INTRI... Lus10003971 9.0 0.7719
AT5G65380 MATE efflux family protein (.1... Lus10015903 10.1 0.7954
AT5G19590 Protein of unknown function, D... Lus10017733 12.1 0.7892
AT1G59900 AT-E1 ALPHA, AT... pyruvate dehydrogenase complex... Lus10010728 13.0 0.7583

Lus10030166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.