Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77700 39 / 3e-05 Pathogenesis-related thaumatin superfamily protein (.1) AT4G11650 36 / 0.0003 ATOSM34 osmotin 34 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017170 [exp] 49 / 2e-08 AT4G11650 251 / 2e-84 osmotin 34 (.1) Lus10007034 [exp] 45 / 2e-07 AT4G11650 293 / 5e-101 osmotin 34 (.1) Lus10006690 [exp] 45 / 2e-07 AT4G11650 292 / 1e-100 osmotin 34 (.1) Lus10006302 [exp] 42 / 4e-06 AT4G11650 294 / 3e-101 osmotin 34 (.1) Lus10005140 [exp] 38 / 7e-05 AT4G11650 117 / 6e-33 osmotin 34 (.1) Lus10034489 [exp] 36 / 0.0006 AT4G24180 173 / 1e-51 THAUMATIN-LIKE PROTEIN 1 (.1) Lus10015591 [exp] 35 / 0.001 AT5G24620 353 / 1e-120 Pathogenesis-related thaumatin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G107950 [exp] 42 / 4e-06 AT4G11650 287 / 6e-99 osmotin 34 (.1) Potri.001G107800 [exp] 42 / 4e-06 AT4G11650 291 / 1e-100 osmotin 34 (.1) Potri.001G107600 [exp] 42 / 4e-06 AT4G11650 356 / 1e-125 osmotin 34 (.1) Potri.001G102400 [exp] 41 / 8e-06 AT4G11650 360 / 2e-127 osmotin 34 (.1) Potri.012G004800 [exp] 36 / 0.0004 AT5G24620 358 / 1e-122 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.001G210400 [exp] 36 / 0.0005 AT1G77700 273 / 1e-90 Pathogenesis-related thaumatin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [flax] [poplar] CDC PF00314 [flax] [poplar] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Lus10030178 pacid=23153001 polypeptide=Lus10030178 locus=Lus10030178.g ID=Lus10030178.BGIv1.0 annot-version=v1.0 ATGGCCGGGGAGACCCGAGGAGACTCATTAGTCTCCAGCTTGACCGCGGGGAGATGGACCATCGATAACGTCCCCTCAGGGACCACAGGAGGCAGGATAT GGGCCCGCACCGGCTGCCAGTTCAACGGTGGCACAGGGCGGTGCCAGACTGGGGGACTGCGGAGGCCTCCTTGA
AA sequence Show only first row Show all	>Lus10030178 pacid=23153001 polypeptide=Lus10030178 locus=Lus10030178.g ID=Lus10030178.BGIv1.0 annot-version=v1.0 MAGETRGDSLVSSLTAGRWTIDNVPSGTTGGRIWARTGCQFNGGTGRCQTGGLRRPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030178 [exp]	0	1
AT3G14460			LRR and NB-ARC domains-contain...		Lus10005321 [exp]	2.0	0.8187
AT1G11390			Protein kinase superfamily pro...		Lus10037869 [exp]	3.6	0.7746
AT3G12010			unknown protein		Lus10021085 [exp]	5.5	0.7855
AT3G51780		ATBAG4	BCL-2-associated athanogene 4 ...		Lus10003393 [exp]	9.9	0.8164
AT3G63150		ATCBG, MIRO2	CALCIUM BINDING GTP-ASE, MIRO-...		Lus10042575 [exp]	11.0	0.7708
AT2G46560			transducin family protein / WD...		Lus10030236 [exp]	15.0	0.8300
AT5G62310		IRE	INCOMPLETE ROOT HAIR ELONGATIO...		Lus10038912 [exp]	15.7	0.7669
AT1G28420	HD	HB-1	homeobox-1 (.1)		Lus10025454 [exp]	22.4	0.7878
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10002603 [exp]	25.3	0.8095
AT5G62310		IRE	INCOMPLETE ROOT HAIR ELONGATIO...		Lus10027196 [exp]	25.9	0.7736

Compare expression of checked genes

Lus10030178 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.