Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46850 128 / 1e-35 Protein kinase superfamily protein (.1) AT1G66880 39 / 0.0004 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005138 [exp] 214 / 2e-67 AT2G46850 607 / 0.0 Protein kinase superfamily protein (.1) Lus10032741 [exp] 38 / 0.0008 AT2G23450 578 / 0.0 Protein kinase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G181100 [exp] 155 / 1e-45 AT2G46850 670 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030180 pacid=23153120 polypeptide=Lus10030180 locus=Lus10030181.g ID=Lus10030180.BGIv1.0 annot-version=v1.0 ATGGAGATGATCGGCGGATCGCAGGTGCCGGCGGCGGTGGCGATTCAGAAGATGAGGAAAGGGAAGGTGGAGGAGATCGTGGATCCGAAGCTGTACTACC ACGAGCAGCCGGGGTTCCGGAGGGAGCAGATGGATGCGGTGGCCGATCTGGCGGCGAGGTGCTTGTTGTTCGGCGGAGGAGGAGGAGGGGAAGTGGCGGC GGGGAAGATAGGGATGGTGGAGGTGGCGAAGGAGCTTGTGCATATAGCGAAGGAGAGCGTCGGCGGCGGGAGTAGTAGGAGAGGTCCGGCGTTGGAAGAG ACGTTCTCCAATTCCAGCTTGCTTCAGATGATTTCCATGTCCCCTGATTCTATACATGTTCCATAA
AA sequence Show only first row Show all	>Lus10030180 pacid=23153120 polypeptide=Lus10030180 locus=Lus10030181.g ID=Lus10030180.BGIv1.0 annot-version=v1.0 MEMIGGSQVPAAVAIQKMRKGKVEEIVDPKLYYHEQPGFRREQMDAVADLAARCLLFGGGGGGEVAAGKIGMVEVAKELVHIAKESVGGGSSRRGPALEE TFSNSSLLQMISMSPDSIHVP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46850			Protein kinase superfamily pro...		Lus10030180 [exp]	0	1
AT2G03170		ASK14	SKP1-like 14 (.1)		Lus10031171 [exp]	11.8	0.7832
AT1G16740			Ribosomal protein L20 (.1)		Lus10033326 [exp]	31.8	0.7437
AT4G03170	B3		AP2/B3-like transcriptional fa...		Lus10043234 [exp]	42.8	0.6523
AT5G45190			Cyclin family protein (.1.2)		Lus10038329 [exp]	44.0	0.7320
AT1G71120		GLIP6	GDSL-motif lipase/hydrolase 6 ...		Lus10034635 [exp]	56.7	0.6932
AT3G56960		PIP5K4	phosphatidyl inositol monophos...		Lus10010458 [exp]	81.2	0.6506
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031568 [exp]	87.2	0.7004
AT2G42910			Phosphoribosyltransferase fami...		Lus10031395 [exp]	87.8	0.6998
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10014178 [exp]	103.2	0.7050
					Lus10014667 [exp]	129.8	0.6851

Compare expression of checked genes

Lus10030180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.