Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77530 56 / 9e-11 O-methyltransferase family protein (.1) AT1G21130 54 / 4e-10 IGMT4 indole glucosinolate O-methyltransferase 4, O-methyltransferase family protein (.1.2) AT1G21110 50 / 5e-09 IGMT3 indole glucosinolate O-methyltransferase 3, O-methyltransferase family protein (.1) AT1G21120 50 / 5e-09 IGMT2 indole glucosinolate O-methyltransferase 2, O-methyltransferase family protein (.1) AT1G77520 50 / 8e-09 O-methyltransferase family protein (.1) AT1G21100 48 / 3e-08 IGMT1 indole glucosinolate O-methyltransferase 1, O-methyltransferase family protein (.1) AT5G54160 47 / 6e-08 ATOMT1 O-methyltransferase 1 (.1) AT1G63140 42 / 3e-06 O-methyltransferase family protein (.1.2) AT5G37170 39 / 8e-05 O-methyltransferase family protein (.1) AT1G76790 39 / 8e-05 IGMT5 indole glucosinolate O-methyltransferase 5, O-methyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002667 [exp] 100 / 5e-27 AT5G54160 368 / 1e-126 O-methyltransferase 1 (.1) Lus10002668 [exp] 97 / 7e-27 AT1G51990 102 / 2e-25 O-methyltransferase family protein (.1.2) Lus10002669 [exp] 84 / 5e-21 AT5G54160 376 / 5e-130 O-methyltransferase 1 (.1) Lus10005133 [exp] 81 / 7e-20 AT5G54160 381 / 1e-131 O-methyltransferase 1 (.1) Lus10006146 [exp] 72 / 2e-16 AT5G54160 338 / 5e-115 O-methyltransferase 1 (.1) Lus10015576 [exp] 46 / 2e-07 AT5G54160 595 / 0.0 O-methyltransferase 1 (.1) Lus10030188 [exp] 45 / 3e-07 AT5G54160 213 / 9e-68 O-methyltransferase 1 (.1) Lus10032929 [exp] 45 / 3e-07 AT5G54160 601 / 0.0 O-methyltransferase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G106600 [exp] 55 / 2e-10 AT5G54160 416 / 3e-145 O-methyltransferase 1 (.1) Potri.001G451100 [exp] 54 / 2e-10 AT5G54160 384 / 7e-133 O-methyltransferase 1 (.1) Potri.012G006400 [exp] 54 / 4e-10 AT5G54160 605 / 0.0 O-methyltransferase 1 (.1) Potri.002G180466 [exp] 52 / 2e-09 AT5G54160 412 / 6e-144 O-methyltransferase 1 (.1) Potri.002G180433 [exp] 52 / 2e-09 AT5G54160 412 / 4e-144 O-methyltransferase 1 (.1) Potri.002G180500 [exp] 52 / 2e-09 AT5G54160 412 / 6e-144 O-methyltransferase 1 (.1) Potri.002G180700 [exp] 51 / 3e-09 AT5G54160 393 / 8e-137 O-methyltransferase 1 (.1) Potri.015G003100 [exp] 51 / 3e-09 AT5G54160 583 / 0.0 O-methyltransferase 1 (.1) Potri.002G180600 [exp] 50 / 4e-09 AT5G54160 413 / 2e-144 O-methyltransferase 1 (.1) Potri.011G150500 [exp] 49 / 2e-08 AT5G54160 364 / 2e-125 O-methyltransferase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF08100 [flax] [poplar] Dimerisation Dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10030187 pacid=23153065 polypeptide=Lus10030187 locus=Lus10030187.g ID=Lus10030187.BGIv1.0 annot-version=v1.0 ATGACATTGCAGGCCGCCAACAAACTCGGAATCTTCGACATCATGGCTGCAGATGCCTCTGGTGCAAAACTAAGCGCCTCTGAAATCGTGTCCAAGTTGG ATTCGGTGACGAATCCAGTTGCTCCGGTCATGGTTGACCGGATTCATAGGCTATTATTGGGGAGTCAATCCATTGTGGATTGCACTTTGGAGGAGAATGG GTCCTAG
AA sequence Show only first row Show all	>Lus10030187 pacid=23153065 polypeptide=Lus10030187 locus=Lus10030187.g ID=Lus10030187.BGIv1.0 annot-version=v1.0 MTLQAANKLGIFDIMAADASGAKLSASEIVSKLDSVTNPVAPVMVDRIHRLLLGSQSIVDCTLEENGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21130		IGMT4	indole glucosinolate O-methylt...		Lus10030187 [exp]	0	1
AT5G51105			Protein of unknown function (D...		Lus10043285 [exp]	1.0	0.9930
AT2G29040			Exostosin family protein (.1)		Lus10016532 [exp]	7.3	0.9215
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	8.9	0.9831
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041829 [exp]	10.5	0.9143
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	11.0	0.9831
AT5G09500			Ribosomal protein S19 family p...		Lus10026127 [exp]	11.8	0.8393
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10030174 [exp]	12.2	0.8138
AT5G40350	MYB	ATMYB24	myb domain protein 24 (.1)		Lus10032129 [exp]	12.6	0.9831
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017677 [exp]	13.7	0.8756
AT5G59540			2-oxoglutarate (2OG) and Fe(II...		Lus10033879 [exp]	14.1	0.9831

Compare expression of checked genes

Lus10030187 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.