Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46800 222 / 7e-73 ATMTP1, ZAT1, ZAT, ATCDF1 ZINC TRANSPORTER OF ARABIDOPSIS THALIANA 1, A. THALIANA CATION DIFFUSION FACILITATOR 1, zinc transporter of Arabidopsis thaliana (.1.2) AT3G58810 215 / 2e-70 ATMTPA2, MTP3, MTPA2, ATMTP3 ARABIDOPSIS METAL TOLERANCE PROTEIN 3, metal tolerance protein A2 (.1.2) AT3G61940 199 / 7e-65 ATMTPA1, MTPA1 Cation efflux family protein (.1) AT2G29410 132 / 2e-38 ATMTPB1, MTPB1 metal tolerance protein B1 (.1) AT1G33020 74 / 3e-16 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002674 [exp] 233 / 3e-77 AT3G58810 503 / 5e-179 ARABIDOPSIS METAL TOLERANCE PROTEIN 3, metal tolerance protein A2 (.1.2) Lus10012604 [exp] 228 / 5e-75 AT3G61940 500 / 2e-177 Cation efflux family protein (.1) Lus10040744 [exp] 124 / 7e-35 AT2G29410 344 / 1e-116 metal tolerance protein B1 (.1) Lus10016487 [exp] 124 / 9e-35 AT2G29410 345 / 8e-117 metal tolerance protein B1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G106200 [exp] 224 / 6e-74 AT2G46800 277 / 4e-90 ZINC TRANSPORTER OF ARABIDOPSIS THALIANA 1, A. THALIANA CATION DIFFUSION FACILITATOR 1, zinc transporter of Arabidopsis thaliana (.1.2) Potri.002G180100 [exp] 222 / 6e-73 AT2G46800 502 / 3e-178 ZINC TRANSPORTER OF ARABIDOPSIS THALIANA 1, A. THALIANA CATION DIFFUSION FACILITATOR 1, zinc transporter of Arabidopsis thaliana (.1.2) Potri.001G450900 [exp] 218 / 1e-70 AT2G46800 285 / 3e-92 ZINC TRANSPORTER OF ARABIDOPSIS THALIANA 1, A. THALIANA CATION DIFFUSION FACILITATOR 1, zinc transporter of Arabidopsis thaliana (.1.2) Potri.011G150600 [exp] 215 / 5e-70 AT3G58810 281 / 2e-91 ARABIDOPSIS METAL TOLERANCE PROTEIN 3, metal tolerance protein A2 (.1.2) Potri.001G245800 [exp] 123 / 7e-35 AT2G29410 336 / 7e-114 metal tolerance protein B1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01545 [flax] [poplar] Cation_efflux Cation efflux family
Representative CDS sequence Show only first row Show all	>Lus10030192 pacid=23153005 polypeptide=Lus10030192 locus=Lus10030192.g ID=Lus10030192.BGIv1.0 annot-version=v1.0 ATGATCGGGGGAGCAATAATATGGTACAAGCCCGAATGGAAGATTGTTGACCTGATATGCACCCTGTTCTTCTCGGTGATAGTGATGGGCACGACAATCA AGATGCTGCGCAATGTTCTGGAAGTCCTGATGGAGAGCACTCCTCGAGAAATCGACGCGACCAAGCTCGAAAAGGGGATTCTGGAGATGGACGAAGTGGT GGCGATCCATGAATTGCACATCTGGGCTATCACGGTTGGGAAGGTGCTCTTGGCTTGTCATGTTAAGATCAGACCGGATGCCAATGCGGACTCGGTGCTC GATAGCGTGGTGAACTACATCAAAAGGGAGTATAATATCAGCCATGTTACCATCCAGATTGAGCGTTAA
AA sequence Show only first row Show all	>Lus10030192 pacid=23153005 polypeptide=Lus10030192 locus=Lus10030192.g ID=Lus10030192.BGIv1.0 annot-version=v1.0 MIGGAIIWYKPEWKIVDLICTLFFSVIVMGTTIKMLRNVLEVLMESTPREIDATKLEKGILEMDEVVAIHELHIWAITVGKVLLACHVKIRPDANADSVL DSVVNYIKREYNISHVTIQIER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Lus10030192 [exp]	0	1
AT2G03690			coenzyme Q biosynthesis Coq4 f...		Lus10026671 [exp]	2.8	0.9167
AT5G08060			unknown protein		Lus10040513 [exp]	3.5	0.9099
AT5G67020			unknown protein		Lus10019344 [exp]	4.4	0.9187
AT1G66080			unknown protein		Lus10010967 [exp]	5.5	0.9156
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10025818 [exp]	7.2	0.9110
AT2G03690			coenzyme Q biosynthesis Coq4 f...		Lus10026673 [exp]	8.1	0.8932
AT5G57360		LKP1, FKL2, ADO...	ZEITLUPE, LOV KELCH PROTEIN 1,...		Lus10025470 [exp]	8.4	0.9103
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032481 [exp]	9.2	0.9079
AT4G33565			RING/U-box superfamily protein...		Lus10012745 [exp]	12.2	0.8903
AT3G18410			Complex I subunit NDUFS6 (.1.2...		Lus10009665 [exp]	12.2	0.8781

Compare expression of checked genes

Lus10030192 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.