Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002679 [exp] 126 / 1e-35 AT4G00800 1922 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G105601 [exp] 78 / 1e-18 AT4G00800 1966 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030198 pacid=23153100 polypeptide=Lus10030198 locus=Lus10030198.g ID=Lus10030198.BGIv1.0 annot-version=v1.0 ATGCCTCAGCTCCGGCTAGCGCCGCCGGCTGTCTACCACGAGAGAATACAGAAAGGGGCACCACAGCTTTTGGCACGAGGCAACGGGAGTGGGGTTACAA AACTCGAGAACCCGAGCAGGAAACTCAGAGATATTAAAGTTAAGGGGACGTCGCTTCGTTTCCCGTTGAAGACGAGCATGTTCAGTAAGATACTCTCGCA GCAATTCATACATTAA
AA sequence Show only first row Show all	>Lus10030198 pacid=23153100 polypeptide=Lus10030198 locus=Lus10030198.g ID=Lus10030198.BGIv1.0 annot-version=v1.0 MPQLRLAPPAVYHERIQKGAPQLLARGNGSGVTKLENPSRKLRDIKVKGTSLRFPLKTSMFSKILSQQFIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10030198 [exp]	0	1
AT2G04880	WRKY	ATWRKY1, ZAP1	zinc-dependent activator prote...		Lus10012322 [exp]	3.5	0.7434
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10042127 [exp]	49.5	0.7094
AT3G51620			PAP/OAS1 substrate-binding dom...		Lus10006094 [exp]	66.0	0.6937
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10038560 [exp]	88.9	0.6980
AT3G47610			transcription regulators;zinc ...		Lus10024226 [exp]	255.5	0.6426

Compare expression of checked genes

Lus10030198 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.