Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14430 60 / 1e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002683 [exp] 119 / 5e-37 AT3G14430 93 / 1e-26 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G105250 [exp] 62 / 2e-14 AT3G14430 50 / 1e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030201 pacid=23153012 polypeptide=Lus10030201 locus=Lus10030201.g ID=Lus10030201.BGIv1.0 annot-version=v1.0 ATGGCGATGAGCAGCACCAGGCAGGGAAGGGCAATAGGAGGACGAAGAAGGGAAGAGCCAATGTTGACTCGTATGGTCACTGCAGTATTTTCCTTAGTCA AGTACTCTGAATTCGAGATCCTCTTCGTTCTTTTCATCCTCATTGCCTTTCTTGTCTTCAAAGATCTCACCTCAAGGCCTGAGTACAATCAAATCCTAGT GAAGAAGCCCGACAGTGGCGACTGGTGGCCTTACTAG
AA sequence Show only first row Show all	>Lus10030201 pacid=23153012 polypeptide=Lus10030201 locus=Lus10030201.g ID=Lus10030201.BGIv1.0 annot-version=v1.0 MAMSSTRQGRAIGGRRREEPMLTRMVTAVFSLVKYSEFEILFVLFILIAFLVFKDLTSRPEYNQILVKKPDSGDWWPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14430			unknown protein		Lus10030201 [exp]	0	1
AT3G14430			unknown protein		Lus10002683 [exp]	1.4	0.8392
AT4G39235			unknown protein		Lus10004160 [exp]	6.3	0.8022
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Lus10006328 [exp]	8.1	0.7492
AT5G22360		ATVAMP714	vesicle-associated membrane pr...		Lus10043394 [exp]	9.3	0.7811
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10032014 [exp]	13.0	0.7461
AT3G08890			Protein of unknown function, D...		Lus10002862 [exp]	14.4	0.7766
AT5G47730			Sec14p-like phosphatidylinosit...		Lus10038752 [exp]	14.6	0.6618
					Lus10040104 [exp]	16.0	0.7649
AT3G23610		DSPTP1	dual specificity protein phosp...		Lus10041227 [exp]	16.6	0.7339
AT3G22950		ATARFC1	ADP-ribosylation factor C1 (.1...		Lus10039392 [exp]	19.0	0.7642

Compare expression of checked genes

Lus10030201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.