Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002685 [exp] 181 / 9e-61 AT3G61930 45 / 4e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G105000 [exp] 49 / 7e-09 AT3G61930 43 / 3e-06 unknown protein Potri.002G179000 [exp] 47 / 5e-08 AT3G61930 51 / 2e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10030203 pacid=23153114 polypeptide=Lus10030203 locus=Lus10030203.g ID=Lus10030203.BGIv1.0 annot-version=v1.0 ATGGGGAACCGACAAGGAAGAAACGCGGCGGTGCAGCCTTTGAATTACCAAGGCGGTGACGGCGAGGAGGCGGCGATAACAGGGCTTCTCTCTCCGGCTC CGACAAGGAGGAGTAATCCTAATGGTGTTAGGATTCGAGTTGGGATGACGATGGGGCAACTTCACGAGTTGATGACTCAGATTCCGGCGTCGAAGTCGAG GAGTAGCAACGAGTGCTCATCGTCGGAGCTTGGTCGGTTGATAATCCGAGAATGCCTGAAGGGTAGGTTTCGAGCTCGTGTTGTTGGCGTCCTGCCTCCA TTTTCGACCCACGAAGACTAA
AA sequence Show only first row Show all	>Lus10030203 pacid=23153114 polypeptide=Lus10030203 locus=Lus10030203.g ID=Lus10030203.BGIv1.0 annot-version=v1.0 MGNRQGRNAAVQPLNYQGGDGEEAAITGLLSPAPTRRSNPNGVRIRVGMTMGQLHELMTQIPASKSRSSNECSSSELGRLIIRECLKGRFRARVVGVLPP FSTHED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61930			unknown protein		Lus10030203 [exp]	0	1
AT5G46060			Protein of unknown function, D...		Lus10005266 [exp]	2.0	0.9566
AT1G70670		AtCLO4	Arabidopsis thaliana caleosin ...		Lus10014588 [exp]	3.5	0.9530
AT3G61930			unknown protein		Lus10002685 [exp]	4.8	0.8861
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10042078 [exp]	4.9	0.9439
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10009340 [exp]	5.2	0.8805
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10013674 [exp]	6.9	0.9326
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10037661 [exp]	6.9	0.9101
AT3G14360			alpha/beta-Hydrolases superfam...		Lus10037465 [exp]	9.4	0.9067
AT2G14095			unknown protein		Lus10035649 [exp]	10.6	0.9088
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10006505 [exp]	11.8	0.9028

Compare expression of checked genes

Lus10030203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.