Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01200 202 / 1e-66 ATRAB-A3, AtRABA3 ARABIDOPSIS RAB GTPASE HOMOLOG A3, RAB GTPase homolog A3 (.1) AT5G65270 172 / 7e-55 AtRABA4a RAB GTPase homolog A4A (.1) AT5G47960 168 / 3e-53 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT4G39990 164 / 8e-52 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT3G12160 161 / 1e-50 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT1G09630 149 / 5e-46 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT1G28550 141 / 1e-42 AtRABA1i RAB GTPase homolog A1I (.1) AT3G15060 140 / 1e-42 AtRABA1g RAB GTPase homolog A1G (.1) AT5G45750 140 / 2e-42 AtRABA1c RAB GTPase homolog A1C (.1) AT1G16920 140 / 2e-42 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005990 [exp] 300 / 8e-106 AT1G01200 206 / 1e-67 ARABIDOPSIS RAB GTPASE HOMOLOG A3, RAB GTPase homolog A3 (.1) Lus10023153 [exp] 161 / 2e-50 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10000637 [exp] 160 / 6e-50 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10025738 [exp] 158 / 3e-49 AT5G65270 404 / 4e-145 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 158 / 3e-49 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1) Lus10023829 [exp] 162 / 4e-49 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10016284 [exp] 155 / 2e-48 AT3G12160 386 / 2e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10021023 [exp] 162 / 9e-48 AT3G12160 384 / 3e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10012032 [exp] 151 / 2e-46 AT3G12160 379 / 1e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G102200 [exp] 224 / 4e-75 AT1G01200 332 / 2e-116 ARABIDOPSIS RAB GTPASE HOMOLOG A3, RAB GTPase homolog A3 (.1) Potri.002G175700 [exp] 216 / 6e-72 AT1G01200 333 / 4e-117 ARABIDOPSIS RAB GTPASE HOMOLOG A3, RAB GTPase homolog A3 (.1) Potri.007G096000 [exp] 165 / 6e-52 AT5G65270 404 / 2e-145 RAB GTPase homolog A4A (.1) Potri.006G057700 [exp] 164 / 6e-52 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.001G270100 [exp] 162 / 6e-51 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.005G073000 [exp] 161 / 1e-50 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1) Potri.016G050400 [exp] 161 / 1e-50 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.003G004100 [exp] 144 / 6e-44 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.010G197200 [exp] 144 / 7e-44 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.004G061000 [exp] 144 / 1e-43 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10030221 pacid=23153013 polypeptide=Lus10030221 locus=Lus10030221.g ID=Lus10030221.BGIv1.0 annot-version=v1.0 ATGTATATTATCGAATACAGGGCAGTTACAAGCGCATACTACAGAGGAGCACTAGGAGCAATGCTGGTGTACGACATCACAAAGAGGCCGACCTTTGACC ACGTGGCGAGGTGGGTGGAGGAGCTCCGGGCCCACGCCGACAGTTCGATCGTGATCATGCTGATCGGCAACAAAGCCGATCTAGCAGGTGACCACAGGGC AGTCCCCACGGAGGACGCGGTGGAGTTTGCCGAGGAGCAGGGGCTCTTCTTCTCGGAGGCCTCAGCGATGAGCGGGGACAACGTGGACAAGGCCTTCTTC CAGGTGCTGGAGAAGGTGCACGCCGCGGTGTCGAAGAAGTCGCTGCAGGCTACAGCTGCGGCCTCTTCTGATGTCGCGAAATCGAACGGAGCGTTGCAAG GGGATAGGATTGATGTGATTAGTGGGGCGGAAATGGAGATAAGTGAGATGAAGAAGTTGCCGTCTTGCTCTTGTTGA
AA sequence Show only first row Show all	>Lus10030221 pacid=23153013 polypeptide=Lus10030221 locus=Lus10030221.g ID=Lus10030221.BGIv1.0 annot-version=v1.0 MYIIEYRAVTSAYYRGALGAMLVYDITKRPTFDHVARWVEELRAHADSSIVIMLIGNKADLAGDHRAVPTEDAVEFAEEQGLFFSEASAMSGDNVDKAFF QVLEKVHAAVSKKSLQATAAASSDVAKSNGALQGDRIDVISGAEMEISEMKKLPSCSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01200		ATRAB-A3, AtRAB...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10030221 [exp]	0	1
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10000763 [exp]	2.2	0.8563
AT3G18430			Calcium-binding EF-hand family...		Lus10022173 [exp]	4.6	0.8228
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Lus10038893 [exp]	6.2	0.8361
AT1G53590		NTMCTYPE6.1 ,NT...	Calcium-dependent lipid-bindin...		Lus10005578 [exp]	8.1	0.7810
AT1G47710			Serine protease inhibitor (SER...		Lus10002792 [exp]	8.9	0.8024
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10036203 [exp]	12.0	0.8194
AT1G53400			Ubiquitin domain-containing pr...		Lus10015233 [exp]	15.9	0.7988
AT5G03990			unknown protein		Lus10016362 [exp]	17.5	0.8150
AT5G28040	GeBP		DNA-binding storekeeper protei...		Lus10000940 [exp]	24.4	0.8148
AT2G37975			Yos1-like protein (.1)		Lus10000226 [exp]	24.5	0.7791

Compare expression of checked genes

Lus10030221 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.