Lus10030222 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16420 376 / 2e-128 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G07740 159 / 5e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G09060 140 / 4e-37 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G01400 131 / 6e-35 unknown protein
AT5G46100 125 / 1e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G61990 122 / 1e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G14580 114 / 1e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G02060 114 / 3e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G64320 114 / 5e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05600 112 / 6e-28 EMB3101 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005989 602 / 0 AT5G16420 656 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10005540 140 / 7e-38 AT5G18475 562 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040869 136 / 1e-36 AT1G07740 491 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10038377 127 / 1e-32 AT4G20090 841 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036238 125 / 5e-32 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10002675 123 / 3e-31 AT4G01400 570 / 0.0 unknown protein
Lus10013972 120 / 8e-31 AT5G46100 520 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015397 120 / 9e-31 AT5G46100 593 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039056 120 / 5e-30 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G031600 392 / 2e-134 AT5G16420 707 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.014G105900 135 / 5e-36 AT4G01400 576 / 0.0 unknown protein
Potri.003G204100 127 / 3e-33 AT1G07740 502 / 2e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G057900 125 / 1e-32 AT5G46100 627 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G179300 123 / 1e-31 AT1G05600 649 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.010G148700 122 / 4e-31 AT3G48810 728 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G379500 120 / 6e-31 AT3G14580 442 / 2e-154 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G223300 120 / 2e-30 AT1G05670 208 / 1e-58 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.010G234500 119 / 1e-29 AT1G74580 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G015900 118 / 2e-29 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10030222 pacid=23153052 polypeptide=Lus10030222 locus=Lus10030222.g ID=Lus10030222.BGIv1.0 annot-version=v1.0
ATGTTACGCTGTGCTCAATCTCGCAGCCGCCTAACCAACCCAACCTCCACCGCCGCCGCCGTACTCATCCGTTCAATTAAGCAAGCGTCCTCGTTTTCCG
CCATCAACGTCGACGCTGAATTCCTCAAATCATACAAAGTAACTCCCCCAATCAAACCCTGGCCGCAGCAGCTCTACCCTAAGCGCCTCGTGACCATGAT
CACTCGCCAGCAGAATCTCGACCTCGCACTCCAAATCTTCAACTACGCAGGCAAATACCACCCCGGATTCTACCACAACTACGACACTTACGAATCCATC
ATTCAGAAGCTCTCCAGAGCTCGCGCATTCGAAGCCATGGAGTCTCTTCTCTCCGAGCTGCGTCATTCTCAAATCAAGTGCGGCGAGAATCTCTTCATAA
CCGTGATTCGTAACTACGGACTCGCCGGGAAGCCCAAGCTTTCCCTCCAGACGTTCCTCCGCATCGAGGATTTTAAAGTGCAGCGATCGGTGAGGTCGTT
GAACACTCTCCTCAACGCGTTCGTGCAGAACAAGAGGTACGATCTCGTCCACTCCATGTTTAAAGATTGTAAGGATCAGTACGGAGTGGTTCCCAATGTC
TTCACTGCCAACATTTTGATCAACGCTCTGTGTAAGTTGAACGACATGGAAGCTGCACTCCAGGTGCTCGACGAAATGCCTGTAATGAGAATGATCCCGA
ATGTAGTGACTTACACTACAATTCTAGCCGGTTACGCTTCAAAAGGCGATATGGAGAAGGCGAAGAAGGTTCTAACCGATCTTTTCAATAAAGGATGGCT
CCCCGATGCTACGACCTACACAATCTTGATGGATGGATATTGCAGGCAAGGAAGACTCGCCGATGCTAACAAAGTTATGGACGATATGGAAGGGGGGCCA
AATGATGTTAATTAA
AA sequence
>Lus10030222 pacid=23153052 polypeptide=Lus10030222 locus=Lus10030222.g ID=Lus10030222.BGIv1.0 annot-version=v1.0
MLRCAQSRSRLTNPTSTAAAVLIRSIKQASSFSAINVDAEFLKSYKVTPPIKPWPQQLYPKRLVTMITRQQNLDLALQIFNYAGKYHPGFYHNYDTYESI
IQKLSRARAFEAMESLLSELRHSQIKCGENLFITVIRNYGLAGKPKLSLQTFLRIEDFKVQRSVRSLNTLLNAFVQNKRYDLVHSMFKDCKDQYGVVPNV
FTANILINALCKLNDMEAALQVLDEMPVMRMIPNVVTYTTILAGYASKGDMEKAKKVLTDLFNKGWLPDATTYTILMDGYCRQGRLADANKVMDDMEGGP
NDVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16420 Pentatricopeptide repeat (PPR-... Lus10030222 0 1
AT2G17670 Tetratricopeptide repeat (TPR)... Lus10041832 3.0 0.8966
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Lus10025418 4.5 0.8795
AT3G22980 Ribosomal protein S5/Elongatio... Lus10004749 4.9 0.8689
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Lus10015290 8.2 0.8827
AT2G17670 Tetratricopeptide repeat (TPR)... Lus10028379 9.8 0.8798
AT1G04840 Tetratricopeptide repeat (TPR)... Lus10020743 12.8 0.8302
AT1G50380 Prolyl oligopeptidase family p... Lus10015387 13.8 0.8652
AT5G07900 Mitochondrial transcription te... Lus10041122 14.7 0.8776
AT3G60410 Protein of unknown function (D... Lus10007850 16.6 0.8224
AT4G04950 AtGRXS17 Arabidopsis thaliana monothiol... Lus10018486 17.0 0.8343

Lus10030222 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.