Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16420 188 / 1e-57 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G46100 99 / 9e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G05670 97 / 1e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) AT3G53700 96 / 2e-23 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22470 93 / 2e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G20090 91 / 1e-21 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G28010 90 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 89 / 7e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G01400 88 / 9e-21 unknown protein AT1G09900 88 / 1e-20 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005989 [exp] 303 / 4e-102 AT5G16420 656 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10028943 [exp] 89 / 7e-22 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040869 [exp] 90 / 3e-21 AT1G07740 491 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007468 [exp] 89 / 5e-21 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036238 [exp] 89 / 7e-21 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015397 [exp] 87 / 3e-20 AT5G46100 593 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012328 [exp] 87 / 3e-20 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038377 [exp] 86 / 4e-20 AT4G20090 841 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10042016 [exp] 86 / 6e-20 AT2G32630 600 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G031600 [exp] 202 / 6e-63 AT5G16420 707 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.011G057900 [exp] 96 / 9e-24 AT5G46100 627 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G074500 [exp] 94 / 6e-23 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G013300 [exp] 94 / 8e-23 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G034200 [exp] 94 / 1e-22 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.001G075900 [exp] 92 / 3e-22 AT4G20090 806 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G034300 [exp] 92 / 3e-22 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G014500 [exp] 92 / 4e-22 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G242200 [exp] 91 / 1e-21 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G257300 [exp] 90 / 2e-21 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10030223 pacid=23153080 polypeptide=Lus10030223 locus=Lus10030223.g ID=Lus10030223.BGIv1.0 annot-version=v1.0 ATGCTGAAGAGGAATTGCTTGCCGGATAATGCAATACTGAGTACGCTTATACACTGGCTTTGTAAAGCTGGAAAAGCTTGGGAGGCAAGGAAGCTGTTTG ACGAGTTTGAGATTGGTTCGAGTCCGAGTCTTTTGACCTACAACACCCTGATTGCGGGGATGTGTGGTTGTAGTGAGCTGGGGGAGGCTGGGAAGCTGTG GGATGATATGTTGGAGAAAGGTCATAGGCCGAATGCTCTCACTTATAGCTTGTTAATCAAGGGGTTCTGTGAAAGTGGGAATGTGAAGGAAGGGATTAAG ATTCTAATAGAGATGTTGAGTGATGGATGCCGGCCTGAGAGGTCTACTTACGAGTTGTTGATCGGACGATTGAGGGAATTGCGGATGGAAGGAGTTGTGT GTAATGTGGTTTCGGTGGCGATCAAGCGTGGCGGCGTTGATGAGTTTTTCTTGAAGGATTTTGTCCGCTGTAGAGAGGAGGAGTGTTGTTCATAA
AA sequence Show only first row Show all	>Lus10030223 pacid=23153080 polypeptide=Lus10030223 locus=Lus10030223.g ID=Lus10030223.BGIv1.0 annot-version=v1.0 MLKRNCLPDNAILSTLIHWLCKAGKAWEARKLFDEFEIGSSPSLLTYNTLIAGMCGCSELGEAGKLWDDMLEKGHRPNALTYSLLIKGFCESGNVKEGIK ILIEMLSDGCRPERSTYELLIGRLRELRMEGVVCNVVSVAIKRGGVDEFFLKDFVRCREEECCS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16420			Pentatricopeptide repeat (PPR-...		Lus10030223 [exp]	0	1
AT2G39020			Acyl-CoA N-acyltransferases (N...		Lus10023533 [exp]	7.1	0.8694
AT1G31830			Amino acid permease family pro...		Lus10012153 [exp]	7.6	0.8647
AT2G29900		PS2	Presenilin-2 (.1)		Lus10035137 [exp]	8.1	0.8412
AT3G08590		iPGAM2	2,3-biphosphoglycerate-indepen...		Lus10031877 [exp]	8.8	0.8638
					Lus10036954 [exp]	12.8	0.8218
AT4G00390	GeBP		DNA-binding storekeeper protei...		Lus10028550 [exp]	14.3	0.8366
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10041902 [exp]	18.1	0.8314
AT3G16050		A37, ATPDX1.2	ARABIDOPSIS THALIANA PYRIDOXIN...		Lus10011450 [exp]	18.7	0.8427
AT5G65720		ATNIFS1, NIFS1 ...	NITROGEN FIXATION S HOMOLOG 1,...		Lus10011590 [exp]	20.1	0.8240
AT3G17880		ATHIP2, ATTDX	HSC-70 INTERACTING PROTEIN, AR...		Lus10031334 [exp]	24.0	0.8296

Compare expression of checked genes

Lus10030223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.