Lus10030250 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61780 112 / 5e-30 EMB1703 embryo defective 1703 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004004 147 / 2e-42 AT3G61780 671 / 0.0 embryo defective 1703 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G099100 134 / 9e-38 AT3G61780 805 / 0.0 embryo defective 1703 (.1)
PFAM info
Representative CDS sequence
>Lus10030250 pacid=23153200 polypeptide=Lus10030250 locus=Lus10030250.g ID=Lus10030250.BGIv1.0 annot-version=v1.0
ATGTTGTCTAGAGTAACGAACTTGGTTGATCAGTATGAGAACGAGGAAGATTTCTTGTGGTGGCTTGATCTTCCACATGTGCTGGCACACTTGGAAATGC
TTGGAACCGGCCACGCTTTCGTCGTTCCTAGACCACCAAAGGATTCCTTCAGAGAAGCCAAAGCAAACGGGTTCAGTGTTACTGTAATCAGGAAAGGGCA
ACTGCAGATGGACATAGACCAGCCATTGGAGGTGGTGGAGGAAGAGATCGGCGAGATCGGGAGCAAAATCTACCACGATAAACTGATGCAGGAGTGCAGC
GTTGACGTGAACTCGCTTATGAAGGGCGTTCTCTGGAGGTAA
AA sequence
>Lus10030250 pacid=23153200 polypeptide=Lus10030250 locus=Lus10030250.g ID=Lus10030250.BGIv1.0 annot-version=v1.0
MLSRVTNLVDQYENEEDFLWWLDLPHVLAHLEMLGTGHAFVVPRPPKDSFREAKANGFSVTVIRKGQLQMDIDQPLEVVEEEIGEIGSKIYHDKLMQECS
VDVNSLMKGVLWR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61780 EMB1703 embryo defective 1703 (.1) Lus10030250 0 1
AT5G20140 SOUL heme-binding family prote... Lus10040682 16.8 0.4971
AT1G06050 Protein of unknown function (D... Lus10005308 22.1 0.4726
Lus10005485 27.6 0.4527
AT4G16835 Tetratricopeptide repeat (TPR)... Lus10000596 51.6 0.4341
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Lus10009144 120.7 0.3681

Lus10030250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.