Lus10030253 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61770 219 / 8e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G67600 124 / 7e-37 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 117 / 2e-34 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G21610 108 / 9e-31 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT3G12685 79 / 9e-19 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006432 120 / 3e-35 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10011373 119 / 4e-35 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10035299 108 / 2e-30 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10036984 103 / 3e-29 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10000883 100 / 2e-27 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 100 / 4e-27 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 99 / 6e-26 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10014550 92 / 5e-25 AT3G61770 115 / 4e-33 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 61 / 1e-11 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G171300 237 / 8e-80 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G056600 124 / 9e-37 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.011G087100 113 / 1e-32 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.014G156000 104 / 4e-29 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 101 / 5e-28 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.010G176100 62 / 2e-12 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10030253 pacid=23152990 polypeptide=Lus10030253 locus=Lus10030253.g ID=Lus10030253.BGIv1.0 annot-version=v1.0
ATGTCCGGGTTATGGGCTTGGTTCGCTGCTCAGTCGATCAAGATATGTTTGAATTTTTTCGTGGAGAGGAAGTGGGATTTCAGGATTCTGTTTGCTTCCG
GTGGGATGCCGTCCTCCCACTCTGCTCTGTGTACTGCTTTGACTACGGCCGTGGCTCTCTGCCATGGCGTGGCGGATTCTTTGTTTCCGGTTTGTTTGGG
GTTTAGCCTTATTGTTATGTACGATGCTATTGGCGTCAGGCGCCATGCCGGGATGCAAGCTGAGGTTCTAAACAAGATAGTTGAGGATCTGTTCCAAGGG
CATCCAATAAGTGAAAGAAAGTTGAAGGAGCTATTGGGTCATACTCCATCCCAAGTCTTTGCTGGAGCTCTGCTGGGGATTTTGGTAGCCTGTATCTGTT
GCCAGGGTTGCTTAGTTGCGACCTAA
AA sequence
>Lus10030253 pacid=23152990 polypeptide=Lus10030253 locus=Lus10030253.g ID=Lus10030253.BGIv1.0 annot-version=v1.0
MSGLWAWFAAQSIKICLNFFVERKWDFRILFASGGMPSSHSALCTALTTAVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNKIVEDLFQG
HPISERKLKELLGHTPSQVFAGALLGILVACICCQGCLVAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61770 Acid phosphatase/vanadium-depe... Lus10030253 0 1
AT1G66080 unknown protein Lus10010967 1.7 0.9238
AT3G63000 NPL41 NPL4-like protein 1 (.1) Lus10021567 5.7 0.9136
AT3G06150 unknown protein Lus10004424 7.5 0.8898
AT2G38050 DWF6, DET2, ATD... DWARF 6, DE-ETIOLATED 2, 3-oxo... Lus10021127 7.7 0.8986
AT5G57360 LKP1, FKL2, ADO... ZEITLUPE, LOV KELCH PROTEIN 1,... Lus10025470 8.9 0.9024
AT2G03690 coenzyme Q biosynthesis Coq4 f... Lus10026673 9.8 0.8834
AT5G64510 TIN1 tunicamycin induced 1, unknown... Lus10020502 9.9 0.9069
AT2G46800 ATMTP1, ZAT1, Z... ZINC TRANSPORTER OF ARABIDOPSI... Lus10030192 14.1 0.8888
Lus10019698 15.2 0.8774
AT3G14240 Subtilase family protein (.1) Lus10037449 15.5 0.8815

Lus10030253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.